Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 1704551..1705326 | Replicon | chromosome |
| Accession | NZ_CP100182 | ||
| Organism | Burkholderia glumae strain R5 | ||
Toxin (Protein)
| Gene name | TacT2 | Uniprot ID | C5AIF4 |
| Locus tag | NIW68_RS23970 | Protein ID | WP_015877380.1 |
| Coordinates | 1704551..1705048 (-) | Length | 166 a.a. |
Antitoxin (Protein)
| Gene name | TacA2 | Uniprot ID | C5AIF5 |
| Locus tag | NIW68_RS23975 | Protein ID | WP_015877381.1 |
| Coordinates | 1705045..1705326 (-) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIW68_RS23935 | 1700572..1700667 | - | 96 | Protein_1346 | IS5/IS1182 family transposase | - |
| NIW68_RS23940 | 1700739..1701284 | - | 546 | Protein_1347 | IS3 family transposase | - |
| NIW68_RS23945 | 1701477..1702282 | + | 806 | WP_085962370.1 | IS5 family transposase | - |
| NIW68_RS23950 | 1702248..1702559 | - | 312 | WP_015877377.1 | hypothetical protein | - |
| NIW68_RS23955 | 1702576..1702878 | - | 303 | WP_255220127.1 | DUF2380 domain-containing protein | - |
| NIW68_RS23960 | 1702954..1703559 | - | 606 | Protein_1351 | RHS repeat-associated core domain-containing protein | - |
| NIW68_RS23965 | 1703973..1704470 | - | 498 | WP_015877379.1 | ProQ/FINO family protein | - |
| NIW68_RS23970 | 1704551..1705048 | - | 498 | WP_015877380.1 | GNAT family N-acetyltransferase | Toxin |
| NIW68_RS23975 | 1705045..1705326 | - | 282 | WP_015877381.1 | DUF1778 domain-containing protein | Antitoxin |
| NIW68_RS23980 | 1705323..1705700 | - | 378 | WP_173941242.1 | hypothetical protein | - |
| NIW68_RS23985 | 1705783..1706145 | - | 363 | WP_017432434.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | fliC | 1688558..1730874 | 42316 | |
| - | flank | IS/Tn | - | - | 1700715..1701257 | 542 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 166 a.a. Molecular weight: 17544.11 Da Isoelectric Point: 9.6894
>T250300 WP_015877380.1 NZ_CP100182:c1705048-1704551 [Burkholderia glumae]
VTGWRAPEPLSDAHGLDDFDSGVASLDTWLKRRALANQRSGASRTFVATRDGRVGAYYALASGAVTLEVAPGRFRRNMPD
PIPVVVLGRLAVDRAHQGIGVGRALVRDAGLRVLHAAAAIGIRGLIVHALSDSAKAFYERVGFEASPLDPMLLLITLADL
EHALS
VTGWRAPEPLSDAHGLDDFDSGVASLDTWLKRRALANQRSGASRTFVATRDGRVGAYYALASGAVTLEVAPGRFRRNMPD
PIPVVVLGRLAVDRAHQGIGVGRALVRDAGLRVLHAAAAIGIRGLIVHALSDSAKAFYERVGFEASPLDPMLLLITLADL
EHALS
Download Length: 498 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J9HNC8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J9HNC9 |