Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapC-vagC/VapC-VagC
Location 125019..125656 Replicon plasmid p86s4p
Accession NZ_CP100179
Organism Burkholderia glumae strain BGR86S

Toxin (Protein)


Gene name vapC Uniprot ID C5AP38
Locus tag NIW65_RS31465 Protein ID WP_012735347.1
Coordinates 125019..125420 (-) Length 134 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID C5AP39
Locus tag NIW65_RS31470 Protein ID WP_012735348.1
Coordinates 125420..125656 (-) Length 79 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIW65_RS31435 121482..121751 + 270 WP_012735343.1 hypothetical protein -
NIW65_RS31440 121911..122525 + 615 Protein_113 error-prone DNA polymerase -
NIW65_RS31445 122541..122828 + 288 WP_012735344.1 hypothetical protein -
NIW65_RS31450 123932..124126 - 195 WP_124837731.1 hypothetical protein -
NIW65_RS31455 124181..124423 - 243 WP_012735345.1 hypothetical protein -
NIW65_RS31460 124441..125004 - 564 WP_012735346.1 hypothetical protein -
NIW65_RS31465 125019..125420 - 402 WP_012735347.1 type II toxin-antitoxin system VapC family toxin Toxin
NIW65_RS31470 125420..125656 - 237 WP_012735348.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NIW65_RS31475 125993..126682 - 690 WP_257739423.1 hypothetical protein -
NIW65_RS31480 126769..128595 - 1827 WP_012735349.1 site-specific integrase -
NIW65_RS31485 128592..128972 - 381 WP_080569442.1 hypothetical protein -
NIW65_RS31490 128975..129292 - 318 WP_050811486.1 hypothetical protein -
NIW65_RS31495 129343..130431 - 1089 Protein_124 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..132942 132942


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-117)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 134 a.a.        Molecular weight: 14847.12 Da        Isoelectric Point: 5.2138

>T250299 WP_012735347.1 NZ_CP100179:c125420-125019 [Burkholderia glumae]
MPRFMLDTNMCIYLMKNQPEQVAKRFAECFVGDVVMSAITYAELEYGVAVSDNRAKERRNLAALIEDILVAPFDAAAAVA
YGPIREATRERKKDHLDKLIAAHAVALDVVLVTNNAKDFASYPGIKLDNWLND

Download         Length: 402 bp

Antitoxin


Download         Length: 79 a.a.        Molecular weight: 8983.13 Da        Isoelectric Point: 6.3676

>AT250299 WP_012735348.1 NZ_CP100179:c125656-125420 [Burkholderia glumae]
MQTTRVFRNGNSQAVRIPADLAYERSDVELEIERVGDEIRIRPARRPLTGVLKKFAKFSQDFMAEGRGEQEQAEREGM

Download         Length: 237 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB C5AP38

Antitoxin

Source ID Structure
AlphaFold DB C5AP39

References