Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
| Location | 85406..86001 | Replicon | plasmid p86s3p |
| Accession | NZ_CP100178 | ||
| Organism | Burkholderia glumae strain BGR86S | ||
Toxin (Protein)
| Gene name | chpB | Uniprot ID | C5AN78 |
| Locus tag | NIW65_RS30800 | Protein ID | WP_012734107.1 |
| Coordinates | 85406..85756 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | chpS | Uniprot ID | C5AN79 |
| Locus tag | NIW65_RS30805 | Protein ID | WP_012734108.1 |
| Coordinates | 85750..86001 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIW65_RS30775 | 80628..81374 | - | 747 | WP_232252306.1 | energy transducer TonB | - |
| NIW65_RS30780 | 81406..83781 | - | 2376 | WP_232252305.1 | TonB-dependent receptor | - |
| NIW65_RS30785 | 84095..84559 | - | 465 | WP_012734106.1 | Lrp/AsnC family transcriptional regulator | - |
| NIW65_RS30790 | 84782..85003 | - | 222 | WP_017433768.1 | hypothetical protein | - |
| NIW65_RS30795 | 85153..85347 | - | 195 | WP_124837685.1 | hypothetical protein | - |
| NIW65_RS30800 | 85406..85756 | - | 351 | WP_012734107.1 | type II toxin-antitoxin system ChpB family toxin | Toxin |
| NIW65_RS30805 | 85750..86001 | - | 252 | WP_012734108.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| NIW65_RS30810 | 86264..86671 | - | 408 | WP_230674618.1 | hypothetical protein | - |
| NIW65_RS30815 | 86774..88609 | - | 1836 | WP_012732711.1 | site-specific integrase | - |
| NIW65_RS30820 | 88612..88953 | - | 342 | WP_012732710.1 | hypothetical protein | - |
| NIW65_RS30825 | 89010..89255 | - | 246 | WP_127913916.1 | hypothetical protein | - |
| NIW65_RS30830 | 89252..89494 | - | 243 | WP_124837682.1 | hypothetical protein | - |
| NIW65_RS30835 | 89508..89792 | - | 285 | WP_017432347.1 | hypothetical protein | - |
| NIW65_RS30840 | 90180..90497 | - | 318 | WP_148271069.1 | hypothetical protein | - |
| NIW65_RS30845 | 90681..90962 | - | 282 | WP_043308454.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..92653 | 92653 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12389.37 Da Isoelectric Point: 8.8909
>T250298 WP_012734107.1 NZ_CP100178:c85756-85406 [Burkholderia glumae]
MVKRVKFERGDIVRVSLSPTVGREQQGDFRPALVLSPAAFNALGVALVAPITQGGEFARFAGFAVPLSGSGTETQGVALV
NMVRMLDLEGRGARKIERAPVEVVEDALARLQTIIE
MVKRVKFERGDIVRVSLSPTVGREQQGDFRPALVLSPAAFNALGVALVAPITQGGEFARFAGFAVPLSGSGTETQGVALV
NMVRMLDLEGRGARKIERAPVEVVEDALARLQTIIE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A246MF70 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A246MFN5 |