Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapC-vagC/VapC-VagC |
Location | 122811..123449 | Replicon | plasmid p49s4p |
Accession | NZ_CP100161 | ||
Organism | Burkholderia glumae strain BGR49S |
Toxin (Protein)
Gene name | vapC | Uniprot ID | C5AP38 |
Locus tag | NIW54_RS33160 | Protein ID | WP_012735347.1 |
Coordinates | 122811..123212 (-) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | - |
Locus tag | NIW54_RS33165 | Protein ID | WP_257765493.1 |
Coordinates | 123222..123449 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIW54_RS33130 | 119274..119543 | + | 270 | WP_012735343.1 | hypothetical protein | - |
NIW54_RS33135 | 119703..120317 | + | 615 | Protein_110 | error-prone DNA polymerase | - |
NIW54_RS33140 | 120333..120620 | + | 288 | WP_012735344.1 | hypothetical protein | - |
NIW54_RS33145 | 121725..121919 | - | 195 | WP_124837731.1 | hypothetical protein | - |
NIW54_RS33150 | 121974..122216 | - | 243 | WP_012735345.1 | hypothetical protein | - |
NIW54_RS33155 | 122234..122446 | - | 213 | WP_257765492.1 | hypothetical protein | - |
NIW54_RS33160 | 122811..123212 | - | 402 | WP_012735347.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NIW54_RS33165 | 123222..123449 | - | 228 | WP_257765493.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
NIW54_RS33170 | 123785..124474 | - | 690 | WP_257739423.1 | hypothetical protein | - |
NIW54_RS33175 | 124561..126388 | - | 1828 | Protein_118 | site-specific integrase | - |
NIW54_RS33180 | 126385..126765 | - | 381 | WP_080569442.1 | hypothetical protein | - |
NIW54_RS33185 | 126768..127085 | - | 318 | WP_050811486.1 | hypothetical protein | - |
NIW54_RS33190 | 127136..128224 | - | 1089 | Protein_121 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..128913 | 128913 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14847.12 Da Isoelectric Point: 5.2138
>T250287 WP_012735347.1 NZ_CP100161:c123212-122811 [Burkholderia glumae]
MPRFMLDTNMCIYLMKNQPEQVAKRFAECFVGDVVMSAITYAELEYGVAVSDNRAKERRNLAALIEDILVAPFDAAAAVA
YGPIREATRERKKDHLDKLIAAHAVALDVVLVTNNAKDFASYPGIKLDNWLND
MPRFMLDTNMCIYLMKNQPEQVAKRFAECFVGDVVMSAITYAELEYGVAVSDNRAKERRNLAALIEDILVAPFDAAAAVA
YGPIREATRERKKDHLDKLIAAHAVALDVVLVTNNAKDFASYPGIKLDNWLND
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|