Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
| Location | 124866..125461 | Replicon | plasmid p82s1p |
| Accession | NZ_CP100152 | ||
| Organism | Burkholderia glumae strain BGR82S | ||
Toxin (Protein)
| Gene name | chpB | Uniprot ID | C5AN78 |
| Locus tag | NIV83_RS31135 | Protein ID | WP_012734107.1 |
| Coordinates | 124866..125216 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | chpS | Uniprot ID | C5AN79 |
| Locus tag | NIV83_RS31140 | Protein ID | WP_012734108.1 |
| Coordinates | 125210..125461 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIV83_RS31110 | 120088..120834 | - | 747 | WP_232252306.1 | energy transducer TonB | - |
| NIV83_RS31115 | 120866..123241 | - | 2376 | WP_232252305.1 | TonB-dependent receptor | - |
| NIV83_RS31120 | 123555..124019 | - | 465 | WP_012734106.1 | Lrp/AsnC family transcriptional regulator | - |
| NIV83_RS31125 | 124242..124463 | - | 222 | WP_017433768.1 | hypothetical protein | - |
| NIV83_RS31130 | 124613..124807 | - | 195 | WP_124837685.1 | hypothetical protein | - |
| NIV83_RS31135 | 124866..125216 | - | 351 | WP_012734107.1 | type II toxin-antitoxin system ChpB family toxin | Toxin |
| NIV83_RS31140 | 125210..125461 | - | 252 | WP_012734108.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| NIV83_RS31145 | 125724..126131 | - | 408 | WP_230674618.1 | hypothetical protein | - |
| NIV83_RS31150 | 126234..128069 | - | 1836 | WP_012732711.1 | site-specific integrase | - |
| NIV83_RS31155 | 128072..128413 | - | 342 | WP_012732710.1 | hypothetical protein | - |
| NIV83_RS31160 | 128470..128715 | - | 246 | WP_127913916.1 | hypothetical protein | - |
| NIV83_RS31165 | 128712..128954 | - | 243 | WP_124837682.1 | hypothetical protein | - |
| NIV83_RS31170 | 128968..129252 | - | 285 | WP_017432347.1 | hypothetical protein | - |
| NIV83_RS31175 | 129640..129957 | - | 318 | WP_148271069.1 | hypothetical protein | - |
| NIV83_RS31180 | 130141..130422 | - | 282 | WP_043308454.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..132942 | 132942 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12389.37 Da Isoelectric Point: 8.8909
>T250281 WP_012734107.1 NZ_CP100152:c125216-124866 [Burkholderia glumae]
MVKRVKFERGDIVRVSLSPTVGREQQGDFRPALVLSPAAFNALGVALVAPITQGGEFARFAGFAVPLSGSGTETQGVALV
NMVRMLDLEGRGARKIERAPVEVVEDALARLQTIIE
MVKRVKFERGDIVRVSLSPTVGREQQGDFRPALVLSPAAFNALGVALVAPITQGGEFARFAGFAVPLSGSGTETQGVALV
NMVRMLDLEGRGARKIERAPVEVVEDALARLQTIIE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A246MF70 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A246MFN5 |