Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapC-vagC/VapC-VagC
Location 125436..126073 Replicon plasmid p39s4p
Accession NZ_CP100149
Organism Burkholderia glumae strain BGR39S

Toxin (Protein)


Gene name vapC Uniprot ID C5AP38
Locus tag NIV98_RS31915 Protein ID WP_012735347.1
Coordinates 125436..125837 (-) Length 134 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID C5AP39
Locus tag NIV98_RS31920 Protein ID WP_012735348.1
Coordinates 125837..126073 (-) Length 79 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIV98_RS31885 121899..122168 + 270 WP_012735343.1 hypothetical protein -
NIV98_RS31890 122328..122942 + 615 Protein_112 error-prone DNA polymerase -
NIV98_RS31895 122958..123245 + 288 WP_012735344.1 hypothetical protein -
NIV98_RS31900 124349..124543 - 195 WP_124837731.1 hypothetical protein -
NIV98_RS31905 124598..124840 - 243 WP_012735345.1 hypothetical protein -
NIV98_RS31910 124858..125421 - 564 WP_012735346.1 hypothetical protein -
NIV98_RS31915 125436..125837 - 402 WP_012735347.1 type II toxin-antitoxin system VapC family toxin Toxin
NIV98_RS31920 125837..126073 - 237 WP_012735348.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NIV98_RS31925 126410..127099 - 690 WP_257739423.1 hypothetical protein -
NIV98_RS31930 127186..129012 - 1827 WP_012735349.1 site-specific integrase -
NIV98_RS31935 129009..129389 - 381 WP_080569442.1 hypothetical protein -
NIV98_RS31940 129392..129709 - 318 WP_050811486.1 hypothetical protein -
NIV98_RS31945 129760..130848 - 1089 Protein_123 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..132942 132942


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-117)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 134 a.a.        Molecular weight: 14847.12 Da        Isoelectric Point: 5.2138

>T250279 WP_012735347.1 NZ_CP100149:c125837-125436 [Burkholderia glumae]
MPRFMLDTNMCIYLMKNQPEQVAKRFAECFVGDVVMSAITYAELEYGVAVSDNRAKERRNLAALIEDILVAPFDAAAAVA
YGPIREATRERKKDHLDKLIAAHAVALDVVLVTNNAKDFASYPGIKLDNWLND

Download         Length: 402 bp

Antitoxin


Download         Length: 79 a.a.        Molecular weight: 8983.13 Da        Isoelectric Point: 6.3676

>AT250279 WP_012735348.1 NZ_CP100149:c126073-125837 [Burkholderia glumae]
MQTTRVFRNGNSQAVRIPADLAYERSDVELEIERVGDEIRIRPARRPLTGVLKKFAKFSQDFMAEGRGEQEQAEREGM

Download         Length: 237 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB C5AP38

Antitoxin

Source ID Structure
AlphaFold DB C5AP39

References