Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 1765..2302 | Replicon | plasmid p33s2p |
Accession | NZ_CP100143 | ||
Organism | Burkholderia glumae strain BGR33S |
Toxin (Protein)
Gene name | parE | Uniprot ID | C5AN85 |
Locus tag | NIV89_RS30415 | Protein ID | WP_012734112.1 |
Coordinates | 2000..2302 (+) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | C5AN86 |
Locus tag | NIV89_RS30410 | Protein ID | WP_012734113.1 |
Coordinates | 1765..2010 (+) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIV89_RS30405 | 1417..1611 | + | 195 | WP_043308437.1 | hypothetical protein | - |
NIV89_RS30410 | 1765..2010 | + | 246 | WP_012734113.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
NIV89_RS30415 | 2000..2302 | + | 303 | WP_012734112.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NIV89_RS30420 | 2462..2704 | + | 243 | WP_043308436.1 | hypothetical protein | - |
NIV89_RS30425 | 2912..3367 | + | 456 | WP_012734111.1 | hypothetical protein | - |
NIV89_RS30430 | 3371..3652 | + | 282 | WP_043308454.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
NIV89_RS30435 | 3830..4153 | + | 324 | WP_043308435.1 | hypothetical protein | - |
NIV89_RS30440 | 4541..4825 | + | 285 | WP_017432347.1 | hypothetical protein | - |
NIV89_RS30445 | 4839..5081 | + | 243 | WP_124837682.1 | hypothetical protein | - |
NIV89_RS30450 | 5078..5323 | + | 246 | WP_127913916.1 | hypothetical protein | - |
NIV89_RS30455 | 5380..5721 | + | 342 | WP_012732710.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..185317 | 185317 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11548.11 Da Isoelectric Point: 6.7171
>T250275 WP_012734112.1 NZ_CP100143:2000-2302 [Burkholderia glumae]
MRGKARVVRLTPLAEADLEDIWAYIFEQWSLAQAEQYVGEIVAAFNRLARGEWVGAVRGEPYRRYLVGFHAVFYRETTDA
LDVACVRHQRMDVGSHLSQY
MRGKARVVRLTPLAEADLEDIWAYIFEQWSLAQAEQYVGEIVAAFNRLARGEWVGAVRGEPYRRYLVGFHAVFYRETTDA
LDVACVRHQRMDVGSHLSQY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|