Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
Location | 11257..11852 | Replicon | plasmid p33s1p |
Accession | NZ_CP100142 | ||
Organism | Burkholderia glumae strain BGR33S |
Toxin (Protein)
Gene name | chpB | Uniprot ID | C5AN78 |
Locus tag | NIV89_RS29675 | Protein ID | WP_012734107.1 |
Coordinates | 11502..11852 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | C5AN79 |
Locus tag | NIV89_RS29670 | Protein ID | WP_012734108.1 |
Coordinates | 11257..11508 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIV89_RS29635 | 6526..6714 | + | 189 | WP_017432455.1 | hypothetical protein | - |
NIV89_RS29640 | 7466..7750 | + | 285 | WP_017432347.1 | hypothetical protein | - |
NIV89_RS29645 | 7764..8006 | + | 243 | WP_124837682.1 | hypothetical protein | - |
NIV89_RS29650 | 8003..8248 | + | 246 | WP_127913916.1 | hypothetical protein | - |
NIV89_RS29655 | 8305..8646 | + | 342 | WP_012732710.1 | hypothetical protein | - |
NIV89_RS29660 | 8649..10484 | + | 1836 | WP_012732711.1 | site-specific integrase | - |
NIV89_RS29665 | 10587..10994 | + | 408 | WP_230674618.1 | hypothetical protein | - |
NIV89_RS29670 | 11257..11508 | + | 252 | WP_012734108.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
NIV89_RS29675 | 11502..11852 | + | 351 | WP_012734107.1 | type II toxin-antitoxin system ChpB family toxin | Toxin |
NIV89_RS29680 | 11911..12105 | + | 195 | WP_124837685.1 | hypothetical protein | - |
NIV89_RS29685 | 12255..12476 | + | 222 | WP_017433768.1 | hypothetical protein | - |
NIV89_RS29690 | 12699..13163 | + | 465 | WP_012734106.1 | Lrp/AsnC family transcriptional regulator | - |
NIV89_RS29695 | 13477..15852 | + | 2376 | WP_232252305.1 | TonB-dependent receptor | - |
NIV89_RS29700 | 15884..16630 | + | 747 | WP_232252306.1 | energy transducer TonB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..145028 | 145028 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12389.37 Da Isoelectric Point: 8.8909
>T250274 WP_012734107.1 NZ_CP100142:11502-11852 [Burkholderia glumae]
MVKRVKFERGDIVRVSLSPTVGREQQGDFRPALVLSPAAFNALGVALVAPITQGGEFARFAGFAVPLSGSGTETQGVALV
NMVRMLDLEGRGARKIERAPVEVVEDALARLQTIIE
MVKRVKFERGDIVRVSLSPTVGREQQGDFRPALVLSPAAFNALGVALVAPITQGGEFARFAGFAVPLSGSGTETQGVALV
NMVRMLDLEGRGARKIERAPVEVVEDALARLQTIIE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A246MF70 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A246MFN5 |