Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1716865..1717469 Replicon chromosome
Accession NZ_CP100140
Organism Burkholderia glumae strain BGR33S

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag NIV89_RS08035 Protein ID WP_017922254.1
Coordinates 1717287..1717469 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag NIV89_RS08030 Protein ID WP_017922253.1
Coordinates 1716865..1717260 (-) Length 132 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIV89_RS07995 1711869..1712084 + 216 WP_155296969.1 hypothetical protein -
NIV89_RS08000 1712084..1713034 + 951 WP_155296968.1 helix-turn-helix domain-containing protein -
NIV89_RS08005 1713031..1714773 + 1743 WP_017922248.1 toprim domain-containing protein -
NIV89_RS08010 1714793..1715302 + 510 WP_017922249.1 hypothetical protein -
NIV89_RS08015 1715349..1715567 + 219 WP_017922250.1 hypothetical protein -
NIV89_RS08020 1715551..1716144 + 594 WP_017922251.1 hypothetical protein -
NIV89_RS08025 1716137..1716568 + 432 WP_157384052.1 hypothetical protein -
NIV89_RS08030 1716865..1717260 - 396 WP_017922253.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
NIV89_RS08035 1717287..1717469 - 183 WP_017922254.1 type II toxin-antitoxin system HicA family toxin Toxin
NIV89_RS08040 1717620..1718240 + 621 WP_017922255.1 hypothetical protein -
NIV89_RS08045 1718246..1718521 + 276 WP_157384053.1 DUF2591 family protein -
NIV89_RS08050 1718571..1719275 + 705 WP_257755349.1 hypothetical protein -
NIV89_RS08055 1719328..1721400 + 2073 WP_257755350.1 phage terminase large subunit family protein -
NIV89_RS08060 1721417..1721665 + 249 WP_039201402.1 gpW family head-tail joining protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1704918..1748547 43629


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(6-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-123)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6599.76 Da        Isoelectric Point: 11.2641

>T250271 WP_017922254.1 NZ_CP100140:c1717469-1717287 [Burkholderia glumae]
MNSANLIRTLKADGWYLVNTVGSHHQFKHATKPGKVTVPHPKKDLPLGTVRSILKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 132 a.a.        Molecular weight: 14466.21 Da        Isoelectric Point: 4.5532

>AT250271 WP_017922253.1 NZ_CP100140:c1717260-1716865 [Burkholderia glumae]
MLYPLYVHVGDDKHAHGVTFPDFPGCHAAADSWDELPAAVQEAAQAHFEGDDSPIPEPSALEDLTRDPEYTGGVWMIFDI
DLSKINTKAVRFNVSMSERLLQKIDAKARARKLSRSAFLAIAAEHEMEADA

Download         Length: 396 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References