Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapC-vagC/VapC-VagC
Location 161210..161847 Replicon plasmid p932p
Accession NZ_CP100139
Organism Burkholderia glumae strain R93

Toxin (Protein)


Gene name vapC Uniprot ID C5AP38
Locus tag NIV78_RS30740 Protein ID WP_012735347.1
Coordinates 161210..161611 (-) Length 134 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID -
Locus tag NIV78_RS30745 Protein ID WP_017924531.1
Coordinates 161611..161847 (-) Length 79 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIV78_RS30700 156234..156551 - 318 Protein_152 integrase core domain-containing protein -
NIV78_RS30705 156733..157209 + 477 WP_012734051.1 transposase -
NIV78_RS30710 157185..157535 + 351 WP_012732753.1 IS66 family insertion sequence element accessory protein TnpB -
NIV78_RS30715 157567..159123 + 1557 WP_012732752.1 IS66 family transposase -
NIV78_RS30720 159045..159383 + 339 Protein_156 hypothetical protein -
NIV78_RS30725 159600..160328 + 729 WP_252836676.1 IS6 family transposase -
NIV78_RS30730 160369..160614 - 246 WP_171467079.1 hypothetical protein -
NIV78_RS30735 160632..161195 - 564 WP_012735346.1 hypothetical protein -
NIV78_RS30740 161210..161611 - 402 WP_012735347.1 type II toxin-antitoxin system VapC family toxin Toxin
NIV78_RS30745 161611..161847 - 237 WP_017924531.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NIV78_RS30750 162279..163988 - 1710 WP_153479184.1 methyl-accepting chemotaxis protein -
NIV78_RS30755 164202..164609 - 408 WP_230674553.1 hypothetical protein -
NIV78_RS30760 164712..166547 - 1836 WP_257758146.1 site-specific integrase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..170947 170947


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-117)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 134 a.a.        Molecular weight: 14847.12 Da        Isoelectric Point: 5.2138

>T250270 WP_012735347.1 NZ_CP100139:c161611-161210 [Burkholderia glumae]
MPRFMLDTNMCIYLMKNQPEQVAKRFAECFVGDVVMSAITYAELEYGVAVSDNRAKERRNLAALIEDILVAPFDAAAAVA
YGPIREATRERKKDHLDKLIAAHAVALDVVLVTNNAKDFASYPGIKLDNWLND

Download         Length: 402 bp

Antitoxin


Download         Length: 79 a.a.        Molecular weight: 8965.10 Da        Isoelectric Point: 6.3676

>AT250270 WP_017924531.1 NZ_CP100139:c161847-161611 [Burkholderia glumae]
MQTTRVFRNGNSQAVRIPADLAYERSDVELEIERVGDEIRIRPARRPLTGVLKKFAKFSQDFMAEGRGEQEQAEREGL

Download         Length: 237 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB C5AP38

Antitoxin

Source ID Structure

References