Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
| Location | 12017..12612 | Replicon | plasmid p932p |
| Accession | NZ_CP100139 | ||
| Organism | Burkholderia glumae strain R93 | ||
Toxin (Protein)
| Gene name | chpB | Uniprot ID | C5AN78 |
| Locus tag | NIV78_RS30000 | Protein ID | WP_012734107.1 |
| Coordinates | 12262..12612 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | chpS | Uniprot ID | C5AN79 |
| Locus tag | NIV78_RS29995 | Protein ID | WP_012734108.1 |
| Coordinates | 12017..12268 (+) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIV78_RS29960 | 7371..7790 | - | 420 | WP_237657883.1 | hypothetical protein | - |
| NIV78_RS29965 | 7787..8440 | - | 654 | WP_017923861.1 | hypothetical protein | - |
| NIV78_RS29970 | 8457..9665 | - | 1209 | WP_257758135.1 | YadA-like family protein | - |
| NIV78_RS29975 | 9708..9761 | - | 54 | Protein_8 | hypothetical protein | - |
| NIV78_RS29980 | 9829..10557 | - | 729 | WP_252836676.1 | IS6 family transposase | - |
| NIV78_RS29985 | 10600..11244 | + | 645 | WP_254220801.1 | site-specific integrase | - |
| NIV78_RS29990 | 11347..11754 | + | 408 | WP_230674618.1 | hypothetical protein | - |
| NIV78_RS29995 | 12017..12268 | + | 252 | WP_012734108.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| NIV78_RS30000 | 12262..12612 | + | 351 | WP_012734107.1 | type II toxin-antitoxin system ChpB family toxin | Toxin |
| NIV78_RS30005 | 12671..12865 | + | 195 | WP_124837685.1 | hypothetical protein | - |
| NIV78_RS30010 | 13015..13236 | + | 222 | WP_017433768.1 | hypothetical protein | - |
| NIV78_RS30015 | 13459..13923 | + | 465 | WP_012734106.1 | Lrp/AsnC family transcriptional regulator | - |
| NIV78_RS30020 | 14225..16612 | + | 2388 | WP_051071184.1 | TonB-dependent receptor | - |
| NIV78_RS30025 | 16644..17390 | + | 747 | WP_232252306.1 | energy transducer TonB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..170947 | 170947 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12389.37 Da Isoelectric Point: 8.8909
>T250269 WP_012734107.1 NZ_CP100139:12262-12612 [Burkholderia glumae]
MVKRVKFERGDIVRVSLSPTVGREQQGDFRPALVLSPAAFNALGVALVAPITQGGEFARFAGFAVPLSGSGTETQGVALV
NMVRMLDLEGRGARKIERAPVEVVEDALARLQTIIE
MVKRVKFERGDIVRVSLSPTVGREQQGDFRPALVLSPAAFNALGVALVAPITQGGEFARFAGFAVPLSGSGTETQGVALV
NMVRMLDLEGRGARKIERAPVEVVEDALARLQTIIE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A246MF70 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A246MFN5 |