Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 1115057..1115832 | Replicon | chromosome |
| Accession | NZ_CP100137 | ||
| Organism | Burkholderia glumae strain R93 | ||
Toxin (Protein)
| Gene name | TacT2 | Uniprot ID | - |
| Locus tag | NIV78_RS22250 | Protein ID | WP_017423245.1 |
| Coordinates | 1115335..1115832 (+) | Length | 166 a.a. |
Antitoxin (Protein)
| Gene name | TacA2 | Uniprot ID | - |
| Locus tag | NIV78_RS22245 | Protein ID | WP_017423246.1 |
| Coordinates | 1115057..1115338 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIV78_RS22215 | 1110653..1110814 | - | 162 | Protein_1029 | IS110 family transposase | - |
| NIV78_RS22225 | 1111996..1112157 | + | 162 | Protein_1031 | integrase core domain-containing protein | - |
| NIV78_RS22230 | 1112615..1113175 | + | 561 | WP_124837867.1 | type 1 fimbrial protein | - |
| NIV78_RS22235 | 1113285..1113551 | + | 267 | Protein_1033 | fimbria/pilus periplasmic chaperone | - |
| NIV78_RS22245 | 1115057..1115338 | + | 282 | WP_017423246.1 | DUF1778 domain-containing protein | Antitoxin |
| NIV78_RS22250 | 1115335..1115832 | + | 498 | WP_017423245.1 | GNAT family N-acetyltransferase | Toxin |
| NIV78_RS22255 | 1115913..1116410 | + | 498 | WP_251107809.1 | ProQ/FINO family protein | - |
| NIV78_RS22260 | 1116826..1117431 | + | 606 | Protein_1038 | RHS repeat-associated core domain-containing protein | - |
| NIV78_RS22265 | 1117567..1117809 | + | 243 | WP_257757996.1 | TIGR02269 family lipoprotein | - |
| NIV78_RS22270 | 1117826..1118110 | + | 285 | WP_153478924.1 | hypothetical protein | - |
| NIV78_RS22275 | 1118233..1118778 | + | 546 | Protein_1041 | IS3 family transposase | - |
| NIV78_RS22280 | 1118850..1118945 | + | 96 | Protein_1042 | IS5/IS1182 family transposase | - |
| NIV78_RS22285 | 1119031..1120380 | - | 1350 | WP_017424540.1 | allantoin permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | fliC | 1108835..1130463 | 21628 | |
| - | inside | IScluster/Tn | - | - | 1113584..1118802 | 5218 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 166 a.a. Molecular weight: 17606.19 Da Isoelectric Point: 9.6894
>T250267 WP_017423245.1 NZ_CP100137:1115335-1115832 [Burkholderia glumae]
MTGWRAPEPLSDAHGLDDFDSGVASLDTWLKRRALANQRSGASRTFVATRDGRVGAYYALASGAVTLEVAPGRFRRNMPD
PIPVVVLGRLAVDRAHQGIGVGRALVRDAGLRVLHAAAAIGIRSLIVHALSDSAKAFYERVGFEASPLDPMLLLITLADL
EHALS
MTGWRAPEPLSDAHGLDDFDSGVASLDTWLKRRALANQRSGASRTFVATRDGRVGAYYALASGAVTLEVAPGRFRRNMPD
PIPVVVLGRLAVDRAHQGIGVGRALVRDAGLRVLHAAAAIGIRSLIVHALSDSAKAFYERVGFEASPLDPMLLLITLADL
EHALS
Download Length: 498 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|