Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 2788718..2789322 | Replicon | chromosome |
| Accession | NZ_CP100136 | ||
| Organism | Burkholderia glumae strain R93 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | NIV78_RS13105 | Protein ID | WP_257744545.1 |
| Coordinates | 2788718..2788900 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NIV78_RS13110 | Protein ID | WP_257756920.1 |
| Coordinates | 2788927..2789322 (+) | Length | 132 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIV78_RS13075 | 2784203..2784451 | - | 249 | WP_017922259.1 | gpW family head-tail joining protein | - |
| NIV78_RS13080 | 2784468..2786540 | - | 2073 | WP_257756915.1 | phage terminase large subunit family protein | - |
| NIV78_RS13085 | 2786593..2787297 | - | 705 | WP_257756917.1 | hypothetical protein | - |
| NIV78_RS13090 | 2787347..2787592 | - | 246 | WP_257744548.1 | hypothetical protein | - |
| NIV78_RS13095 | 2787579..2787941 | - | 363 | WP_257744547.1 | DUF2591 domain-containing protein | - |
| NIV78_RS13100 | 2787947..2788540 | - | 594 | WP_257756919.1 | hypothetical protein | - |
| NIV78_RS13105 | 2788718..2788900 | + | 183 | WP_257744545.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NIV78_RS13110 | 2788927..2789322 | + | 396 | WP_257756920.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NIV78_RS13115 | 2789540..2789845 | + | 306 | WP_257756922.1 | hypothetical protein | - |
| NIV78_RS13120 | 2789849..2790028 | - | 180 | WP_257756923.1 | hypothetical protein | - |
| NIV78_RS13125 | 2790149..2790580 | - | 432 | WP_157384052.1 | hypothetical protein | - |
| NIV78_RS13130 | 2790573..2791166 | - | 594 | WP_124837745.1 | hypothetical protein | - |
| NIV78_RS13135 | 2791304..2791624 | - | 321 | WP_124837795.1 | hypothetical protein | - |
| NIV78_RS13140 | 2791652..2793451 | - | 1800 | WP_257756925.1 | toprim domain-containing protein | - |
| NIV78_RS13145 | 2793448..2793900 | - | 453 | WP_051415274.1 | HNH endonuclease signature motif containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2706717..2810494 | 103777 | |
| - | inside | Prophage | - | - | 2644170..2810494 | 166324 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6614.73 Da Isoelectric Point: 11.2641
>T250265 WP_257744545.1 NZ_CP100136:2788718-2788900 [Burkholderia glumae]
MNSANLLRTLKADGWYLVNTVGSHHQFKHATKPGKVTVPHPKKDLPQGTVRSILKQAGLK
MNSANLLRTLKADGWYLVNTVGSHHQFKHATKPGKVTVPHPKKDLPQGTVRSILKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14421.17 Da Isoelectric Point: 4.5331
>AT250265 WP_257756920.1 NZ_CP100136:2788927-2789322 [Burkholderia glumae]
MLYPLYVHVGDDKHAHGVTFPDFPGCHAAADSWDELPAAVQEAAQAHFEGDDSPIPEPSALEDLARDPEYTGGVWMIFDI
DLSKINTKAVRFNVSMSERLLLQIDATARERKLSRSAFLALAAEHEMRAGA
MLYPLYVHVGDDKHAHGVTFPDFPGCHAAADSWDELPAAVQEAAQAHFEGDDSPIPEPSALEDLARDPEYTGGVWMIFDI
DLSKINTKAVRFNVSMSERLLLQIDATARERKLSRSAFLALAAEHEMRAGA
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|