Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1582146..1582750 | Replicon | chromosome |
| Accession | NZ_CP100131 | ||
| Organism | Burkholderia glumae strain BGR85S | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | NIH91_RS07260 | Protein ID | WP_257744545.1 |
| Coordinates | 1582568..1582750 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NIH91_RS07255 | Protein ID | WP_017922253.1 |
| Coordinates | 1582146..1582541 (-) | Length | 132 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIH91_RS07220 | 1577150..1577365 | + | 216 | WP_155296969.1 | hypothetical protein | - |
| NIH91_RS07225 | 1577365..1578315 | + | 951 | WP_155296968.1 | helix-turn-helix domain-containing protein | - |
| NIH91_RS07230 | 1578312..1580054 | + | 1743 | WP_052231208.1 | toprim domain-containing protein | - |
| NIH91_RS07235 | 1580074..1580583 | + | 510 | WP_257744542.1 | hypothetical protein | - |
| NIH91_RS07240 | 1580630..1580848 | + | 219 | WP_017922250.1 | hypothetical protein | - |
| NIH91_RS07245 | 1580862..1581425 | + | 564 | WP_257744543.1 | hypothetical protein | - |
| NIH91_RS07250 | 1581418..1581849 | + | 432 | WP_257744544.1 | hypothetical protein | - |
| NIH91_RS07255 | 1582146..1582541 | - | 396 | WP_017922253.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NIH91_RS07260 | 1582568..1582750 | - | 183 | WP_257744545.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NIH91_RS07265 | 1582901..1583521 | + | 621 | WP_257744546.1 | hypothetical protein | - |
| NIH91_RS07270 | 1583527..1583889 | + | 363 | WP_257744547.1 | DUF2591 domain-containing protein | - |
| NIH91_RS07275 | 1583876..1584121 | + | 246 | WP_257744548.1 | hypothetical protein | - |
| NIH91_RS07280 | 1584171..1584875 | + | 705 | WP_251108520.1 | hypothetical protein | - |
| NIH91_RS07285 | 1584928..1587000 | + | 2073 | WP_017922258.1 | phage terminase large subunit family protein | - |
| NIH91_RS07290 | 1587017..1587265 | + | 249 | WP_017922259.1 | gpW family head-tail joining protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1568848..1611373 | 42525 | |
| - | inside | Prophage | - | - | 1568848..1613664 | 44816 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6614.73 Da Isoelectric Point: 11.2641
>T250261 WP_257744545.1 NZ_CP100131:c1582750-1582568 [Burkholderia glumae]
MNSANLLRTLKADGWYLVNTVGSHHQFKHATKPGKVTVPHPKKDLPQGTVRSILKQAGLK
MNSANLLRTLKADGWYLVNTVGSHHQFKHATKPGKVTVPHPKKDLPQGTVRSILKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14466.21 Da Isoelectric Point: 4.5532
>AT250261 WP_017922253.1 NZ_CP100131:c1582541-1582146 [Burkholderia glumae]
MLYPLYVHVGDDKHAHGVTFPDFPGCHAAADSWDELPAAVQEAAQAHFEGDDSPIPEPSALEDLTRDPEYTGGVWMIFDI
DLSKINTKAVRFNVSMSERLLQKIDAKARARKLSRSAFLAIAAEHEMEADA
MLYPLYVHVGDDKHAHGVTFPDFPGCHAAADSWDELPAAVQEAAQAHFEGDDSPIPEPSALEDLTRDPEYTGGVWMIFDI
DLSKINTKAVRFNVSMSERLLQKIDAKARARKLSRSAFLAIAAEHEMEADA
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|