Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 163476..164119 Replicon plasmid pGZKP13-1
Accession NZ_CP100121
Organism Klebsiella pneumoniae strain GZKP13

Toxin (Protein)


Gene name vagD Uniprot ID V0UN72
Locus tag NIK98_RS27595 Protein ID WP_001034044.1
Coordinates 163703..164119 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID B1P7N7
Locus tag NIK98_RS27590 Protein ID WP_001261286.1
Coordinates 163476..163706 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIK98_RS27550 (158782) 158782..159057 + 276 WP_000239529.1 hypothetical protein -
NIK98_RS27555 (159249) 159249..159675 - 427 Protein_192 site-specific integrase -
NIK98_RS27560 (159855) 159855..160445 + 591 Protein_193 colicin-B -
NIK98_RS27570 (161214) 161214..161408 - 195 Protein_195 colicin M immunity protein -
NIK98_RS27575 (161580) 161580..162389 - 810 WP_000016963.1 site-specific integrase -
NIK98_RS27580 (162390) 162390..162695 - 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB -
NIK98_RS27585 (162697) 162697..162915 - 219 WP_000813634.1 type II toxin-antitoxin system antitoxin CcdA -
NIK98_RS27590 (163476) 163476..163706 + 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NIK98_RS27595 (163703) 163703..164119 + 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin Toxin
NIK98_RS27600 (164194) 164194..165759 + 1566 WP_001128474.1 AAA family ATPase -
NIK98_RS27605 (165744) 165744..166766 + 1023 WP_000361402.1 helicase UvrD -
NIK98_RS27610 (167020) 167020..167706 - 687 Protein_203 IS1 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(A) / aph(6)-Id / aph(3'')-Ib / catA1 / aph(3')-Ia / mph(A) / dfrA12 / aadA2 / qacE / sul1 / qnrB52 / blaTEM-1B / blaCTX-M-14 / cmlA1 / sitABCD iutA / iucD / iucC / iucB / iucA 1..185954 185954
- flank IS/Tn - - 160461..160964 503
- flank IS/Tn - - 167020..167367 347


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15232.66 Da        Isoelectric Point: 6.8536

>T250256 WP_001034044.1 NZ_CP100121:163703-164119 [Klebsiella pneumoniae]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8747.86 Da        Isoelectric Point: 4.3775

>AT250256 WP_001261286.1 NZ_CP100121:163476-163706 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLELEKADPDFMTEREDVVSDEGRVNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CHW1

Antitoxin

Source ID Structure
AlphaFold DB A0A829CKZ6

References