Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 162390..162915 | Replicon | plasmid pGZKP13-1 |
| Accession | NZ_CP100121 | ||
| Organism | Klebsiella pneumoniae strain GZKP13 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | S1PFV8 |
| Locus tag | NIK98_RS27580 | Protein ID | WP_001159871.1 |
| Coordinates | 162390..162695 (-) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | S1PPD8 |
| Locus tag | NIK98_RS27585 | Protein ID | WP_000813634.1 |
| Coordinates | 162697..162915 (-) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIK98_RS27545 (158144) | 158144..158788 | + | 645 | WP_000633913.1 | division plane positioning ATPase MipZ | - |
| NIK98_RS27550 (158782) | 158782..159057 | + | 276 | WP_000239529.1 | hypothetical protein | - |
| NIK98_RS27555 (159249) | 159249..159675 | - | 427 | Protein_192 | site-specific integrase | - |
| NIK98_RS27560 (159855) | 159855..160445 | + | 591 | Protein_193 | colicin-B | - |
| NIK98_RS27570 (161214) | 161214..161408 | - | 195 | Protein_195 | colicin M immunity protein | - |
| NIK98_RS27575 (161580) | 161580..162389 | - | 810 | WP_000016963.1 | site-specific integrase | - |
| NIK98_RS27580 (162390) | 162390..162695 | - | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| NIK98_RS27585 (162697) | 162697..162915 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| NIK98_RS27590 (163476) | 163476..163706 | + | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| NIK98_RS27595 (163703) | 163703..164119 | + | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | - |
| NIK98_RS27600 (164194) | 164194..165759 | + | 1566 | WP_001128474.1 | AAA family ATPase | - |
| NIK98_RS27605 (165744) | 165744..166766 | + | 1023 | WP_000361402.1 | helicase UvrD | - |
| NIK98_RS27610 (167020) | 167020..167706 | - | 687 | Protein_203 | IS1 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(A) / aph(6)-Id / aph(3'')-Ib / catA1 / aph(3')-Ia / mph(A) / dfrA12 / aadA2 / qacE / sul1 / qnrB52 / blaTEM-1B / blaCTX-M-14 / cmlA1 / sitABCD | iutA / iucD / iucC / iucB / iucA | 1..185954 | 185954 | |
| - | flank | IS/Tn | - | - | 160461..160964 | 503 | |
| - | flank | IS/Tn | - | - | 167020..167367 | 347 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11692.49 Da Isoelectric Point: 6.4674
>T250255 WP_001159871.1 NZ_CP100121:c162695-162390 [Klebsiella pneumoniae]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CCE8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 3TCJ | |
| PDB | 2H3A | |
| PDB | 2ADN | |
| PDB | 2ADL | |
| PDB | 3HPW | |
| PDB | 2H3C | |
| PDB | 3G7Z | |
| AlphaFold DB | A0A829CQY2 |