Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 91657..92300 Replicon plasmid pGZKP13-1
Accession NZ_CP100121
Organism Klebsiella pneumoniae strain GZKP13

Toxin (Protein)


Gene name vagD Uniprot ID Q84A06
Locus tag NIK98_RS27150 Protein ID WP_000754566.1
Coordinates 91884..92300 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q84A07
Locus tag NIK98_RS27145 Protein ID WP_001261276.1
Coordinates 91657..91887 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIK98_RS27115 (87222) 87222..88088 - 867 WP_004118283.1 replication initiation protein -
NIK98_RS27120 (88618) 88618..88722 + 105 WP_032409716.1 hypothetical protein -
NIK98_RS27125 (88851) 88851..89108 + 258 WP_000764642.1 hypothetical protein -
NIK98_RS27130 (89166) 89166..89942 - 777 WP_000015958.1 site-specific integrase -
NIK98_RS27135 (89939) 89939..90682 - 744 WP_000129823.1 hypothetical protein -
NIK98_RS27140 (90733) 90733..91083 - 351 WP_000493378.1 hypothetical protein -
NIK98_RS27145 (91657) 91657..91887 + 231 WP_001261276.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NIK98_RS27150 (91884) 91884..92300 + 417 WP_000754566.1 type II toxin-antitoxin system VapC family toxin Toxin
NIK98_RS27155 (92504) 92504..93360 + 857 Protein_112 IS3-like element ISEc15 family transposase -
NIK98_RS27160 (93642) 93642..94718 + 1077 WP_000227969.1 IS110 family transposase -
NIK98_RS27165 (94738) 94738..94839 - 102 Protein_114 Tn3 family transposase -
NIK98_RS27170 (95607) 95607..96263 - 657 WP_228719530.1 DUF4268 domain-containing protein -
NIK98_RS27175 (96401) 96401..97105 - 705 WP_001067858.1 IS6-like element IS26 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(A) / aph(6)-Id / aph(3'')-Ib / catA1 / aph(3')-Ia / mph(A) / dfrA12 / aadA2 / qacE / sul1 / qnrB52 / blaTEM-1B / blaCTX-M-14 / cmlA1 / sitABCD iutA / iucD / iucC / iucB / iucA 1..185954 185954
- inside IScluster/Tn aph(3')-Ia / mph(A) / dfrA12 / aadA2 / qacE / sul1 / qnrB52 / blaTEM-1B / blaCTX-M-14 / cmlA1 - 47644..87006 39362


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15006.52 Da        Isoelectric Point: 9.2957

>T250251 WP_000754566.1 NZ_CP100121:91884-92300 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNVREFARVPGLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8721.74 Da        Isoelectric Point: 4.3533

>AT250251 WP_001261276.1 NZ_CP100121:91657-91887 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A387K1G3

Antitoxin

Source ID Structure
AlphaFold DB A0A387K023

References