Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 69251..69810 Replicon plasmid pGZKP13-1
Accession NZ_CP100121
Organism Klebsiella pneumoniae strain GZKP13

Toxin (Protein)


Gene name relE Uniprot ID S1PMX5
Locus tag NIK98_RS27005 Protein ID WP_000421257.1
Coordinates 69535..69810 (+) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID C1J8K5
Locus tag NIK98_RS27000 Protein ID WP_001178089.1
Coordinates 69251..69535 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIK98_RS26965 (64580) 64580..64786 - 207 Protein_74 phage shock protein operon transcriptional activator -
NIK98_RS26970 (64778) 64778..64981 + 204 Protein_75 SMR family transporter -
NIK98_RS26975 (64975) 64975..65814 + 840 WP_000259031.1 sulfonamide-resistant dihydropteroate synthase Sul1 -
NIK98_RS26980 (65942) 65942..66145 + 204 WP_000376616.1 hypothetical protein -
NIK98_RS26985 (66301) 66301..67506 + 1206 WP_000184001.1 chromate efflux transporter -
NIK98_RS26990 (67517) 67517..67822 + 306 WP_000130000.1 PadR family transcriptional regulator -
NIK98_RS26995 (68036) 68036..68740 + 705 WP_001067855.1 IS6-like element IS26 family transposase -
NIK98_RS27000 (69251) 69251..69535 + 285 WP_001178089.1 ribbon-helix-helix domain-containing protein Antitoxin
NIK98_RS27005 (69535) 69535..69810 + 276 WP_000421257.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NIK98_RS27015 (70622) 70622..70990 + 369 Protein_84 colicin-like pore-forming protein -
NIK98_RS27020 (71012) 71012..71347 - 336 WP_001080730.1 colicin 1A immunity protein -
NIK98_RS27025 (71476) 71476..71823 + 348 WP_000142451.1 DUF6404 family protein -
NIK98_RS27030 (71910) 71910..72614 - 705 WP_001067855.1 IS6-like element IS26 family transposase -
NIK98_RS27035 (72677) 72677..73075 + 399 Protein_88 recombinase family protein -
NIK98_RS27040 (73258) 73258..74118 + 861 WP_000027057.1 broad-spectrum class A beta-lactamase TEM-1 -
NIK98_RS27045 (74448) 74448..74637 + 190 Protein_90 Tn3 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(A) / aph(6)-Id / aph(3'')-Ib / catA1 / aph(3')-Ia / mph(A) / dfrA12 / aadA2 / qacE / sul1 / qnrB52 / blaTEM-1B / blaCTX-M-14 / cmlA1 / sitABCD iutA / iucD / iucC / iucB / iucA 1..185954 185954
- inside IScluster/Tn aph(3')-Ia / mph(A) / dfrA12 / aadA2 / qacE / sul1 / qnrB52 / blaTEM-1B / blaCTX-M-14 / cmlA1 - 47644..87006 39362


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10749.45 Da        Isoelectric Point: 9.9324

>T250250 WP_000421257.1 NZ_CP100121:69535-69810 [Klebsiella pneumoniae]
MELKWTSKALSDLARLYDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFAGEYEIRYELNGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10474.89 Da        Isoelectric Point: 5.6558

>AT250250 WP_001178089.1 NZ_CP100121:69251-69535 [Klebsiella pneumoniae]
MQMKNNTAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAW
ADSLSTDNPLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1PMX5

Antitoxin

Source ID Structure
AlphaFold DB A0A731IHA8

References