Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4884227..4884743 | Replicon | chromosome |
Accession | NZ_CP100120 | ||
Organism | Klebsiella pneumoniae strain GZKP13 |
Toxin (Protein)
Gene name | relE | Uniprot ID | R4YAY3 |
Locus tag | NIK98_RS24000 | Protein ID | WP_004178374.1 |
Coordinates | 4884227..4884511 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | NIK98_RS24005 | Protein ID | WP_002886901.1 |
Coordinates | 4884501..4884743 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIK98_RS23975 (4879711) | 4879711..4879974 | - | 264 | WP_020324507.1 | PTS system, lactose/cellobiose-specific IIB subunit | - |
NIK98_RS23980 (4880104) | 4880104..4880277 | + | 174 | WP_032408826.1 | hypothetical protein | - |
NIK98_RS23985 (4880280) | 4880280..4881023 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
NIK98_RS23990 (4881380) | 4881380..4883518 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
NIK98_RS23995 (4883759) | 4883759..4884223 | + | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
NIK98_RS24000 (4884227) | 4884227..4884511 | - | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NIK98_RS24005 (4884501) | 4884501..4884743 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
NIK98_RS24010 (4884821) | 4884821..4886731 | - | 1911 | WP_004178373.1 | PRD domain-containing protein | - |
NIK98_RS24015 (4886754) | 4886754..4887908 | - | 1155 | WP_004178372.1 | lactonase family protein | - |
NIK98_RS24020 (4887975) | 4887975..4888715 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T250247 WP_004178374.1 NZ_CP100120:c4884511-4884227 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A6THG1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |