Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4140128..4140747 | Replicon | chromosome |
| Accession | NZ_CP100120 | ||
| Organism | Klebsiella pneumoniae strain GZKP13 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | NIK98_RS20555 | Protein ID | WP_002892050.1 |
| Coordinates | 4140529..4140747 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | J2DPF6 |
| Locus tag | NIK98_RS20550 | Protein ID | WP_002892066.1 |
| Coordinates | 4140128..4140502 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIK98_RS20540 (4135280) | 4135280..4136473 | + | 1194 | WP_002892072.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NIK98_RS20545 (4136496) | 4136496..4139642 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| NIK98_RS20550 (4140128) | 4140128..4140502 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
| NIK98_RS20555 (4140529) | 4140529..4140747 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| NIK98_RS20560 (4140906) | 4140906..4141472 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
| NIK98_RS20565 (4141444) | 4141444..4141584 | - | 141 | WP_004147370.1 | hypothetical protein | - |
| NIK98_RS20570 (4141605) | 4141605..4142075 | + | 471 | WP_002892026.1 | YlaC family protein | - |
| NIK98_RS20575 (4142050) | 4142050..4143501 | - | 1452 | WP_002892023.1 | PLP-dependent aminotransferase family protein | - |
| NIK98_RS20580 (4143602) | 4143602..4144300 | + | 699 | WP_002892021.1 | GNAT family protein | - |
| NIK98_RS20585 (4144297) | 4144297..4144437 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
| NIK98_RS20590 (4144437) | 4144437..4144700 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T250245 WP_002892050.1 NZ_CP100120:4140529-4140747 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT250245 WP_002892066.1 NZ_CP100120:4140128-4140502 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GJ93 |