Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4140128..4140747 Replicon chromosome
Accession NZ_CP100120
Organism Klebsiella pneumoniae strain GZKP13

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NIK98_RS20555 Protein ID WP_002892050.1
Coordinates 4140529..4140747 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NIK98_RS20550 Protein ID WP_002892066.1
Coordinates 4140128..4140502 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIK98_RS20540 (4135280) 4135280..4136473 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NIK98_RS20545 (4136496) 4136496..4139642 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
NIK98_RS20550 (4140128) 4140128..4140502 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NIK98_RS20555 (4140529) 4140529..4140747 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NIK98_RS20560 (4140906) 4140906..4141472 + 567 WP_002892030.1 maltose O-acetyltransferase -
NIK98_RS20565 (4141444) 4141444..4141584 - 141 WP_004147370.1 hypothetical protein -
NIK98_RS20570 (4141605) 4141605..4142075 + 471 WP_002892026.1 YlaC family protein -
NIK98_RS20575 (4142050) 4142050..4143501 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
NIK98_RS20580 (4143602) 4143602..4144300 + 699 WP_002892021.1 GNAT family protein -
NIK98_RS20585 (4144297) 4144297..4144437 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NIK98_RS20590 (4144437) 4144437..4144700 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T250245 WP_002892050.1 NZ_CP100120:4140529-4140747 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT250245 WP_002892066.1 NZ_CP100120:4140128-4140502 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References