Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relB-parE/ParE-RHH |
Location | 6593..7173 | Replicon | plasmid pHSKP1-3 |
Accession | NZ_CP100117 | ||
Organism | Klebsiella pneumoniae strain HSKP1 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A8J3DTL7 |
Locus tag | NIL09_RS27545 | Protein ID | WP_071177730.1 |
Coordinates | 6859..7173 (+) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A2X1PRM1 |
Locus tag | NIL09_RS27540 | Protein ID | WP_000093040.1 |
Coordinates | 6593..6871 (+) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIL09_RS27510 (NIL09_27500) | 2653..2802 | - | 150 | WP_032440454.1 | colicin release lysis protein | - |
NIL09_RS27515 (NIL09_27505) | 2887..3144 | - | 258 | WP_032440455.1 | colicin E3-like toxin immunity protein | - |
NIL09_RS27520 (NIL09_27510) | 3154..4839 | - | 1686 | WP_032440457.1 | colicin-like bacteriocin tRNase domain-containing protein | - |
NIL09_RS27525 (NIL09_27515) | 5166..5411 | + | 246 | WP_032440458.1 | hypothetical protein | - |
NIL09_RS27530 (NIL09_27520) | 5685..6056 | + | 372 | WP_001237044.1 | cell envelope integrity protein TolA | - |
NIL09_RS27535 (NIL09_27525) | 6053..6418 | + | 366 | WP_072354022.1 | TonB family protein | - |
NIL09_RS27540 (NIL09_27530) | 6593..6871 | + | 279 | WP_000093040.1 | CopG family ribbon-helix-helix protein | Antitoxin |
NIL09_RS27545 (NIL09_27535) | 6859..7173 | + | 315 | WP_071177730.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NIL09_RS27550 (NIL09_27540) | 7337..7765 | + | 429 | WP_001140599.1 | hypothetical protein | - |
NIL09_RS27555 (NIL09_27545) | 7791..7970 | + | 180 | WP_000165970.1 | Rop family plasmid primer RNA-binding protein | - |
NIL09_RS27560 (NIL09_27550) | 7997..8527 | - | 531 | WP_071177729.1 | hypothetical protein | - |
NIL09_RS27565 (NIL09_27555) | 8534..9265 | - | 732 | WP_071177728.1 | MobC family replication-relaxation protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..10061 | 10061 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11805.73 Da Isoelectric Point: 9.8324
>T250235 WP_071177730.1 NZ_CP100117:6859-7173 [Klebsiella pneumoniae]
MPQVTISALAQRDLQRLQDFLKTKNRLAARKGGEVIVRAIQQLKTLPDIGRPVPFLPLEYKELVIGFGDSGYVMLYRHDR
EMDQIVIVTVRHQKESGYPGADSL
MPQVTISALAQRDLQRLQDFLKTKNRLAARKGGEVIVRAIQQLKTLPDIGRPVPFLPLEYKELVIGFGDSGYVMLYRHDR
EMDQIVIVTVRHQKESGYPGADSL
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|