Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 83019..83662 | Replicon | plasmid pHSKP1-2 |
Accession | NZ_CP100116 | ||
Organism | Klebsiella pneumoniae strain HSKP1 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | C7S9Y5 |
Locus tag | NIL09_RS27385 | Protein ID | WP_001034046.1 |
Coordinates | 83246..83662 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | V0SR71 |
Locus tag | NIL09_RS27380 | Protein ID | WP_001261278.1 |
Coordinates | 83019..83249 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIL09_RS27350 (78529) | 78529..78834 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | - |
NIL09_RS27355 (78836) | 78836..79054 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | - |
NIL09_RS27360 (79646) | 79646..80134 | + | 489 | WP_011254646.1 | hypothetical protein | - |
NIL09_RS27365 (80168) | 80168..81301 | - | 1134 | WP_001542067.1 | DUF3800 domain-containing protein | - |
NIL09_RS27370 (81468) | 81468..82241 | - | 774 | WP_000905949.1 | hypothetical protein | - |
NIL09_RS27375 (82254) | 82254..82754 | - | 501 | WP_000528931.1 | HEPN family nuclease | - |
NIL09_RS27380 (83019) | 83019..83249 | + | 231 | WP_001261278.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
NIL09_RS27385 (83246) | 83246..83662 | + | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NIL09_RS27390 (83707) | 83707..87501 | - | 3795 | WP_001144732.1 | hypothetical protein | - |
NIL09_RS27395 (87848) | 87848..88078 | + | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | - |
NIL09_RS27400 (88075) | 88075..88491 | + | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | ant(3'')-Ia / qacE / cmlA1 / sitABCD | iutA / iucD / iucC / iucB / iucA | 1..110202 | 110202 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14978.31 Da Isoelectric Point: 6.7113
>T250233 WP_001034046.1 NZ_CP100116:83246-83662 [Klebsiella pneumoniae]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9NXF9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0SR71 |