Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 83019..83662 Replicon plasmid pHSKP1-2
Accession NZ_CP100116
Organism Klebsiella pneumoniae strain HSKP1

Toxin (Protein)


Gene name vagD Uniprot ID C7S9Y5
Locus tag NIL09_RS27385 Protein ID WP_001034046.1
Coordinates 83246..83662 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID V0SR71
Locus tag NIL09_RS27380 Protein ID WP_001261278.1
Coordinates 83019..83249 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIL09_RS27350 (78529) 78529..78834 - 306 WP_001159868.1 type II toxin-antitoxin system toxin CcdB -
NIL09_RS27355 (78836) 78836..79054 - 219 WP_000813634.1 type II toxin-antitoxin system antitoxin CcdA -
NIL09_RS27360 (79646) 79646..80134 + 489 WP_011254646.1 hypothetical protein -
NIL09_RS27365 (80168) 80168..81301 - 1134 WP_001542067.1 DUF3800 domain-containing protein -
NIL09_RS27370 (81468) 81468..82241 - 774 WP_000905949.1 hypothetical protein -
NIL09_RS27375 (82254) 82254..82754 - 501 WP_000528931.1 HEPN family nuclease -
NIL09_RS27380 (83019) 83019..83249 + 231 WP_001261278.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NIL09_RS27385 (83246) 83246..83662 + 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin Toxin
NIL09_RS27390 (83707) 83707..87501 - 3795 WP_001144732.1 hypothetical protein -
NIL09_RS27395 (87848) 87848..88078 + 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin -
NIL09_RS27400 (88075) 88075..88491 + 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid ant(3'')-Ia / qacE / cmlA1 / sitABCD iutA / iucD / iucC / iucB / iucA 1..110202 110202


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-53)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 14978.31 Da        Isoelectric Point: 6.7113

>T250233 WP_001034046.1 NZ_CP100116:83246-83662 [Klebsiella pneumoniae]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8853.07 Da        Isoelectric Point: 4.6437

>AT250233 WP_001261278.1 NZ_CP100116:83019-83249 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDRIILRPLRPSWSSFLELEKADPGFMTEREDVVCDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9NXF9

Antitoxin

Source ID Structure
AlphaFold DB V0SR71

References