Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 6550..7109 Replicon plasmid pHSKP1-2
Accession NZ_CP100116
Organism Klebsiella pneumoniae strain HSKP1

Toxin (Protein)


Gene name relE Uniprot ID V0SVC8
Locus tag NIL09_RS26905 Protein ID WP_000421272.1
Coordinates 6550..6825 (-) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID V0SRR3
Locus tag NIL09_RS26910 Protein ID WP_001387467.1
Coordinates 6825..7109 (-) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIL09_RS26870 (2124) 2124..2306 - 183 WP_042344623.1 hypothetical protein -
NIL09_RS26875 (2373) 2373..2662 - 290 Protein_3 type II toxin-antitoxin system RelE/ParE family toxin -
NIL09_RS26880 (2649) 2649..2917 - 269 Protein_4 type II toxin-antitoxin system ParD family antitoxin -
NIL09_RS26885 (3078) 3078..4306 + 1229 WP_113708090.1 IS3-like element IS2 family transposase -
NIL09_RS26890 (4785) 4785..5699 + 915 WP_223429136.1 hypothetical protein -
NIL09_RS26895 (5988) 5988..6116 + 129 Protein_7 IS481 family transposase -
NIL09_RS26900 (6151) 6151..6444 - 294 WP_001105060.1 hypothetical protein -
NIL09_RS26905 (6550) 6550..6825 - 276 WP_000421272.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NIL09_RS26910 (6825) 6825..7109 - 285 WP_001387467.1 ribbon-helix-helix domain-containing protein Antitoxin
NIL09_RS26915 (7714) 7714..8466 + 753 WP_000562172.1 IclR family transcriptional regulator -
NIL09_RS26920 (8512) 8512..8781 - 270 Protein_12 2-keto-3-deoxygluconate permease -
NIL09_RS26925 (8842) 8842..9546 + 705 WP_001067855.1 IS6-like element IS26 family transposase -
NIL09_RS26930 (9599) 9599..9835 - 237 Protein_14 DUF3330 domain-containing protein -
NIL09_RS26935 (10038) 10038..11051 - 1014 WP_000845048.1 class 1 integron integrase IntI1 -
NIL09_RS26940 (11200) 11200..12038 + 839 Protein_16 AadA family aminoglycoside 3''-O-nucleotidyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid ant(3'')-Ia / qacE / cmlA1 / sitABCD iutA / iucD / iucC / iucB / iucA 1..110202 110202


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10749.45 Da        Isoelectric Point: 10.0871

>T250228 WP_000421272.1 NZ_CP100116:c6825-6550 [Klebsiella pneumoniae]
MELKWTSKALSDLSRLFDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFAGEYEIRYEINGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10460.87 Da        Isoelectric Point: 5.6558

>AT250228 WP_001387467.1 NZ_CP100116:c7109-6825 [Klebsiella pneumoniae]
MQMKNNAAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAW
SDSLSTDNPLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0SVC8

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0Y880

References