250220

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 7025..7668 Replicon plasmid pHSKP1-1
Accession NZ_CP100115
Organism Klebsiella pneumoniae strain HSKP1

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag NIL09_RS25915 Protein ID WP_001044770.1
Coordinates 7252..7668 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag NIL09_RS25910 Protein ID WP_001261282.1
Coordinates 7025..7255 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIL09_RS25870 (2174) 2174..2476 + 303 WP_004197636.1 hypothetical protein -
NIL09_RS25875 (2988) 2988..3782 - 795 WP_004197635.1 site-specific integrase -
NIL09_RS25880 (3980) 3980..4996 - 1017 WP_017899884.1 hypothetical protein -
NIL09_RS25885 (5007) 5007..5321 - 315 WP_053389906.1 hypothetical protein -
NIL09_RS25890 (5348) 5348..5743 - 396 WP_017899885.1 hypothetical protein -
NIL09_RS25895 (5912) 5912..6217 - 306 WP_013023785.1 type II toxin-antitoxin system toxin CcdB -
NIL09_RS25900 (6219) 6219..6437 - 219 WP_001568025.1 type II toxin-antitoxin system antitoxin CcdA -
NIL09_RS25905 (6607) 6607..7068 - 462 WP_160880186.1 hypothetical protein -
NIL09_RS25910 (7025) 7025..7255 + 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NIL09_RS25915 (7252) 7252..7668 + 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
NIL09_RS25920 (7742) 7742..9304 + 1563 WP_004206609.1 AAA family ATPase -
NIL09_RS25925 (9289) 9289..10311 + 1023 WP_000361404.1 helicase UvrD -
NIL09_RS25930 (10567) 10567..11264 + 698 WP_223174630.1 IS1 family transposase -
NIL09_RS25935 (11293) 11293..11565 + 273 Protein_15 transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid blaKPC-2 / sul1 / qacE / aadA2 / dfrA12 / catA2 - 1..142065 142065


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T250220 WP_001044770.1 NZ_CP100115:7252-7668 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT250220 WP_001261282.1 NZ_CP100115:7025-7255 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References