250219

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 5912..6437 Replicon plasmid pHSKP1-1
Accession NZ_CP100115
Organism Klebsiella pneumoniae strain HSKP1

Toxin (Protein)


Gene name ccdB Uniprot ID D4HQE7
Locus tag NIL09_RS25895 Protein ID WP_013023785.1
Coordinates 5912..6217 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID W8V2V6
Locus tag NIL09_RS25900 Protein ID WP_001568025.1
Coordinates 6219..6437 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIL09_RS25865 (1551) 1551..2177 + 627 WP_004197649.1 ParA family plasmid-partitioning AAA ATPase -
NIL09_RS25870 (2174) 2174..2476 + 303 WP_004197636.1 hypothetical protein -
NIL09_RS25875 (2988) 2988..3782 - 795 WP_004197635.1 site-specific integrase -
NIL09_RS25880 (3980) 3980..4996 - 1017 WP_017899884.1 hypothetical protein -
NIL09_RS25885 (5007) 5007..5321 - 315 WP_053389906.1 hypothetical protein -
NIL09_RS25890 (5348) 5348..5743 - 396 WP_017899885.1 hypothetical protein -
NIL09_RS25895 (5912) 5912..6217 - 306 WP_013023785.1 type II toxin-antitoxin system toxin CcdB Toxin
NIL09_RS25900 (6219) 6219..6437 - 219 WP_001568025.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
NIL09_RS25905 (6607) 6607..7068 - 462 WP_160880186.1 hypothetical protein -
NIL09_RS25910 (7025) 7025..7255 + 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin -
NIL09_RS25915 (7252) 7252..7668 + 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin -
NIL09_RS25920 (7742) 7742..9304 + 1563 WP_004206609.1 AAA family ATPase -
NIL09_RS25925 (9289) 9289..10311 + 1023 WP_000361404.1 helicase UvrD -
NIL09_RS25930 (10567) 10567..11264 + 698 WP_223174630.1 IS1 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid blaKPC-2 / sul1 / qacE / aadA2 / dfrA12 / catA2 - 1..142065 142065


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11615.30 Da        Isoelectric Point: 6.4672

>T250219 WP_013023785.1 NZ_CP100115:c6217-5912 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8392.34 Da        Isoelectric Point: 4.7405

>AT250219 WP_001568025.1 NZ_CP100115:c6437-6219 [Klebsiella pneumoniae]
MKQRITVTIDSDSYQLLKSADVNISALVNRAMQNEARRLRSERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2J4ZZW6

Antitoxin

Source ID Structure
AlphaFold DB A0A2J4ZZP8

References