Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4809757..4810273 | Replicon | chromosome |
Accession | NZ_CP100114 | ||
Organism | Klebsiella pneumoniae strain HSKP1 |
Toxin (Protein)
Gene name | relE | Uniprot ID | R4YAY3 |
Locus tag | NIL09_RS23265 | Protein ID | WP_004178374.1 |
Coordinates | 4809757..4810041 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | NIL09_RS23270 | Protein ID | WP_002886901.1 |
Coordinates | 4810031..4810273 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIL09_RS23240 (4805241) | 4805241..4805504 | - | 264 | WP_020324507.1 | PTS system, lactose/cellobiose-specific IIB subunit | - |
NIL09_RS23245 (4805634) | 4805634..4805807 | + | 174 | WP_032408826.1 | hypothetical protein | - |
NIL09_RS23250 (4805810) | 4805810..4806553 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
NIL09_RS23255 (4806910) | 4806910..4809048 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
NIL09_RS23260 (4809289) | 4809289..4809753 | + | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
NIL09_RS23265 (4809757) | 4809757..4810041 | - | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NIL09_RS23270 (4810031) | 4810031..4810273 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
NIL09_RS23275 (4810351) | 4810351..4812261 | - | 1911 | WP_004178373.1 | PRD domain-containing protein | - |
NIL09_RS23280 (4812284) | 4812284..4813438 | - | 1155 | WP_004178372.1 | lactonase family protein | - |
NIL09_RS23285 (4813505) | 4813505..4814245 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T250216 WP_004178374.1 NZ_CP100114:c4810041-4809757 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A6THG1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |