Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4059705..4060324 Replicon chromosome
Accession NZ_CP100114
Organism Klebsiella pneumoniae strain HSKP1

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NIL09_RS19775 Protein ID WP_002892050.1
Coordinates 4060106..4060324 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NIL09_RS19770 Protein ID WP_002892066.1
Coordinates 4059705..4060079 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIL09_RS19760 (4054857) 4054857..4056050 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NIL09_RS19765 (4056073) 4056073..4059219 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
NIL09_RS19770 (4059705) 4059705..4060079 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NIL09_RS19775 (4060106) 4060106..4060324 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NIL09_RS19780 (4060483) 4060483..4061049 + 567 WP_002892030.1 maltose O-acetyltransferase -
NIL09_RS19785 (4061021) 4061021..4061161 - 141 WP_004147370.1 hypothetical protein -
NIL09_RS19790 (4061182) 4061182..4061652 + 471 WP_002892026.1 YlaC family protein -
NIL09_RS19795 (4061627) 4061627..4063078 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
NIL09_RS19800 (4063179) 4063179..4063877 + 699 WP_002892021.1 GNAT family protein -
NIL09_RS19805 (4063874) 4063874..4064014 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NIL09_RS19810 (4064014) 4064014..4064277 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T250214 WP_002892050.1 NZ_CP100114:4060106-4060324 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT250214 WP_002892066.1 NZ_CP100114:4059705-4060079 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References