Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4059705..4060324 | Replicon | chromosome |
Accession | NZ_CP100114 | ||
Organism | Klebsiella pneumoniae strain HSKP1 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | NIL09_RS19775 | Protein ID | WP_002892050.1 |
Coordinates | 4060106..4060324 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | J2DPF6 |
Locus tag | NIL09_RS19770 | Protein ID | WP_002892066.1 |
Coordinates | 4059705..4060079 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIL09_RS19760 (4054857) | 4054857..4056050 | + | 1194 | WP_002892072.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NIL09_RS19765 (4056073) | 4056073..4059219 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
NIL09_RS19770 (4059705) | 4059705..4060079 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
NIL09_RS19775 (4060106) | 4060106..4060324 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
NIL09_RS19780 (4060483) | 4060483..4061049 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
NIL09_RS19785 (4061021) | 4061021..4061161 | - | 141 | WP_004147370.1 | hypothetical protein | - |
NIL09_RS19790 (4061182) | 4061182..4061652 | + | 471 | WP_002892026.1 | YlaC family protein | - |
NIL09_RS19795 (4061627) | 4061627..4063078 | - | 1452 | WP_002892023.1 | PLP-dependent aminotransferase family protein | - |
NIL09_RS19800 (4063179) | 4063179..4063877 | + | 699 | WP_002892021.1 | GNAT family protein | - |
NIL09_RS19805 (4063874) | 4063874..4064014 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
NIL09_RS19810 (4064014) | 4064014..4064277 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T250214 WP_002892050.1 NZ_CP100114:4060106-4060324 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT250214 WP_002892066.1 NZ_CP100114:4059705-4060079 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GJ93 |