Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 855625..856282 | Replicon | chromosome |
Accession | NZ_CP100114 | ||
Organism | Klebsiella pneumoniae strain HSKP1 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | W8UCT0 |
Locus tag | NIL09_RS04265 | Protein ID | WP_002916310.1 |
Coordinates | 855872..856282 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W8UQ37 |
Locus tag | NIL09_RS04260 | Protein ID | WP_002916312.1 |
Coordinates | 855625..855891 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIL09_RS04235 (850781) | 850781..852214 | - | 1434 | WP_004185559.1 | 6-phospho-beta-glucosidase BglA | - |
NIL09_RS04240 (852333) | 852333..853061 | - | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
NIL09_RS04245 (853111) | 853111..853422 | + | 312 | WP_004144734.1 | N(4)-acetylcytidine aminohydrolase | - |
NIL09_RS04250 (853586) | 853586..854245 | + | 660 | WP_002916317.1 | hemolysin III family protein | - |
NIL09_RS04255 (854396) | 854396..855379 | - | 984 | WP_020324927.1 | tRNA-modifying protein YgfZ | - |
NIL09_RS04260 (855625) | 855625..855891 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
NIL09_RS04265 (855872) | 855872..856282 | + | 411 | WP_002916310.1 | protein YgfX | Toxin |
NIL09_RS04270 (856289) | 856289..856810 | - | 522 | WP_004144730.1 | flavodoxin FldB | - |
NIL09_RS04275 (856911) | 856911..857807 | + | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
NIL09_RS04280 (857830) | 857830..858543 | + | 714 | WP_002916301.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NIL09_RS04285 (858549) | 858549..860282 | + | 1734 | WP_004149758.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T250207 WP_002916310.1 NZ_CP100114:855872-856282 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GSW7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GY41 |