Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 157174..157919 | Replicon | plasmid pHSKP104-1 |
Accession | NZ_CP100111 | ||
Organism | Klebsiella pneumoniae strain HSKP104 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A331KSM6 |
Locus tag | NIL12_RS27015 | Protein ID | WP_032408901.1 |
Coordinates | 157428..157919 (+) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | - |
Locus tag | NIL12_RS27010 | Protein ID | WP_014386183.1 |
Coordinates | 157174..157440 (+) | Length | 89 a.a. |
Genomic Context
Location: 156090..156575 (486 bp)
Type: Others
Protein ID: WP_014386185.1
Type: Others
Protein ID: WP_014386185.1
Location: 157174..157440 (267 bp)
Type: Antitoxin
Protein ID: WP_014386183.1
Type: Antitoxin
Protein ID: WP_014386183.1
Location: 157428..157919 (492 bp)
Type: Toxin
Protein ID: WP_032408901.1
Type: Toxin
Protein ID: WP_032408901.1
Location: 152726..153139 (414 bp)
Type: Others
Protein ID: WP_013023817.1
Type: Others
Protein ID: WP_013023817.1
Location: 153140..153418 (279 bp)
Type: Others
Protein ID: WP_004152721.1
Type: Others
Protein ID: WP_004152721.1
Location: 153408..153728 (321 bp)
Type: Others
Protein ID: WP_014386190.1
Type: Others
Protein ID: WP_014386190.1
Location: 153809..154033 (225 bp)
Type: Others
Protein ID: WP_014386189.1
Type: Others
Protein ID: WP_014386189.1
Location: 154044..154256 (213 bp)
Type: Others
Protein ID: WP_014386188.1
Type: Others
Protein ID: WP_014386188.1
Location: 154318..154644 (327 bp)
Type: Others
Protein ID: WP_014386187.1
Type: Others
Protein ID: WP_014386187.1
Location: 155281..155631 (351 bp)
Type: Others
Protein ID: WP_014386186.1
Type: Others
Protein ID: WP_014386186.1
Location: 155628..155900 (273 bp)
Type: Others
Protein ID: WP_032408902.1
Type: Others
Protein ID: WP_032408902.1
Location: 156819..156977 (159 bp)
Type: Others
Protein ID: WP_014386184.1
Type: Others
Protein ID: WP_014386184.1
Location: 158360..158611 (252 bp)
Type: Others
Protein ID: WP_032408900.1
Type: Others
Protein ID: WP_032408900.1
Location: 158808..160400 (1593 bp)
Type: Others
Protein ID: Protein_180
Type: Others
Protein ID: Protein_180
Location: 160431..160781 (351 bp)
Type: Others
Protein ID: WP_014386180.1
Type: Others
Protein ID: WP_014386180.1
Location: 160778..161218 (441 bp)
Type: Others
Protein ID: WP_014386179.1
Type: Others
Protein ID: WP_014386179.1
Location: 161480..162235 (756 bp)
Type: Others
Protein ID: WP_032408898.1
Type: Others
Protein ID: WP_032408898.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIL12_RS26960 (NIL12_26940) | 152726..153139 | - | 414 | WP_013023817.1 | helix-turn-helix domain-containing protein | - |
NIL12_RS26965 (NIL12_26945) | 153140..153418 | - | 279 | WP_004152721.1 | helix-turn-helix transcriptional regulator | - |
NIL12_RS26970 (NIL12_26950) | 153408..153728 | - | 321 | WP_014386190.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
NIL12_RS26975 (NIL12_26955) | 153809..154033 | - | 225 | WP_014386189.1 | hypothetical protein | - |
NIL12_RS26980 (NIL12_26960) | 154044..154256 | - | 213 | WP_014386188.1 | hypothetical protein | - |
NIL12_RS26985 (NIL12_26965) | 154318..154644 | - | 327 | WP_014386187.1 | hypothetical protein | - |
NIL12_RS26990 (NIL12_26970) | 155281..155631 | - | 351 | WP_014386186.1 | hypothetical protein | - |
NIL12_RS26995 (NIL12_26975) | 155628..155900 | - | 273 | WP_032408902.1 | hypothetical protein | - |
NIL12_RS27000 (NIL12_26980) | 156090..156575 | + | 486 | WP_014386185.1 | hypothetical protein | - |
NIL12_RS27005 (NIL12_26985) | 156819..156977 | - | 159 | WP_014386184.1 | type I toxin-antitoxin system Hok family toxin | - |
NIL12_RS27010 (NIL12_26990) | 157174..157440 | + | 267 | WP_014386183.1 | DUF1778 domain-containing protein | Antitoxin |
NIL12_RS27015 (NIL12_26995) | 157428..157919 | + | 492 | WP_032408901.1 | GNAT family N-acetyltransferase | Toxin |
NIL12_RS27020 (NIL12_27000) | 158360..158611 | - | 252 | WP_032408900.1 | aldo/keto reductase | - |
NIL12_RS27025 (NIL12_27005) | 158808..160400 | - | 1593 | Protein_180 | IS66 family transposase | - |
NIL12_RS27030 (NIL12_27010) | 160431..160781 | - | 351 | WP_014386180.1 | IS66 family insertion sequence element accessory protein TnpB | - |
NIL12_RS27035 (NIL12_27015) | 160778..161218 | - | 441 | WP_014386179.1 | transposase | - |
NIL12_RS27040 (NIL12_27020) | 161480..162235 | - | 756 | WP_032408898.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | tet(A) / blaOXA-1 / aac(6')-Ib-cr / blaCTX-M-15 / blaTEM-1B / mph(A) | - | 1..201929 | 201929 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17667.46 Da Isoelectric Point: 8.8757
>T250202 WP_032408901.1 NZ_CP100111:157428-157919 [Klebsiella pneumoniae]
VGKVTAPVPLGTSHILAEFHCGEPVLDEWIKHRGLKNQSLGAARTFVVCRGNASQVLAYYSLATGSVTHAIAPGSLRRNM
PDPVPVIILARLAVDTSYHGQGLGADLLHDAVLRCCRVAENIGVRAVMVHALSDSARQFYIHHGFIPSQTQDRTLFLRLP
LIT
VGKVTAPVPLGTSHILAEFHCGEPVLDEWIKHRGLKNQSLGAARTFVVCRGNASQVLAYYSLATGSVTHAIAPGSLRRNM
PDPVPVIILARLAVDTSYHGQGLGADLLHDAVLRCCRVAENIGVRAVMVHALSDSARQFYIHHGFIPSQTQDRTLFLRLP
LIT
Download Length: 492 bp
Antitoxin
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A331KSM6 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |