Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4110896..4111515 Replicon chromosome
Accession NZ_CP100110
Organism Klebsiella pneumoniae strain HSKP104

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NIL12_RS20065 Protein ID WP_002892050.1
Coordinates 4111297..4111515 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NIL12_RS20060 Protein ID WP_002892066.1
Coordinates 4110896..4111270 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIL12_RS20050 (4106048) 4106048..4107241 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NIL12_RS20055 (4107264) 4107264..4110410 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
NIL12_RS20060 (4110896) 4110896..4111270 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NIL12_RS20065 (4111297) 4111297..4111515 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NIL12_RS20070 (4111674) 4111674..4112240 + 567 WP_002892030.1 maltose O-acetyltransferase -
NIL12_RS20075 (4112212) 4112212..4112352 - 141 WP_004147370.1 hypothetical protein -
NIL12_RS20080 (4112373) 4112373..4112843 + 471 WP_002892026.1 YlaC family protein -
NIL12_RS20085 (4112818) 4112818..4114269 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
NIL12_RS20090 (4114370) 4114370..4115068 + 699 WP_002892021.1 GNAT family protein -
NIL12_RS20095 (4115065) 4115065..4115205 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NIL12_RS20100 (4115205) 4115205..4115468 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T250196 WP_002892050.1 NZ_CP100110:4111297-4111515 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT250196 WP_002892066.1 NZ_CP100110:4110896-4111270 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References