Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 181070..181713 | Replicon | plasmid pHSKP107-1 |
| Accession | NZ_CP100107 | ||
| Organism | Klebsiella pneumoniae strain HSKP107 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | - |
| Locus tag | NIL13_RS27155 | Protein ID | WP_014386165.1 |
| Coordinates | 181297..181713 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | - |
| Locus tag | NIL13_RS27150 | Protein ID | WP_032408893.1 |
| Coordinates | 181070..181300 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIL13_RS27125 (NIL13_27105) | 176143..177126 | - | 984 | WP_001471744.1 | NAD(P)H-quinone oxidoreductase | - |
| NIL13_RS27130 (NIL13_27110) | 177145..178293 | - | 1149 | WP_014386168.1 | ABC transporter ATP-binding protein | - |
| NIL13_RS27135 (NIL13_27115) | 178464..179621 | - | 1158 | WP_032408895.1 | acetylornithine deacetylase | - |
| NIL13_RS27140 (NIL13_27120) | 179637..180311 | - | 675 | WP_014386166.1 | DUF1028 domain-containing protein | - |
| NIL13_RS27145 (NIL13_27125) | 180316..180750 | - | 435 | WP_000103648.1 | RidA family protein | - |
| NIL13_RS27150 (NIL13_27130) | 181070..181300 | + | 231 | WP_032408893.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NIL13_RS27155 (NIL13_27135) | 181297..181713 | + | 417 | WP_014386165.1 | PIN domain-containing protein | Toxin |
| NIL13_RS27160 (NIL13_27140) | 182036..183004 | + | 969 | WP_074422984.1 | IS5-like element IS903B family transposase | - |
| NIL13_RS27165 (NIL13_27145) | 183184..183558 | - | 375 | WP_032408891.1 | hypothetical protein | - |
| NIL13_RS27170 (NIL13_27150) | 183614..183940 | - | 327 | WP_004152639.1 | hypothetical protein | - |
| NIL13_RS27175 (NIL13_27155) | 183937..184665 | - | 729 | WP_014386162.1 | plasmid SOS inhibition protein A | - |
| NIL13_RS27180 (NIL13_27160) | 184662..185093 | - | 432 | WP_014386161.1 | conjugation system SOS inhibitor PsiB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(A) / blaOXA-1 / aac(6')-Ib-cr / blaCTX-M-15 / blaTEM-1B / mph(A) | - | 1..201929 | 201929 | |
| - | flank | IS/Tn | - | - | 182036..183004 | 968 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15127.44 Da Isoelectric Point: 7.8841
>T250184 WP_014386165.1 NZ_CP100107:181297-181713 [Klebsiella pneumoniae]
MTKTYMLDTNICSYIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGAIGKRASPRHVQLVDAFCARLDAILAWDRA
AVDATTEVKATLAAAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVAGLTFEDWVQ
MTKTYMLDTNICSYIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGAIGKRASPRHVQLVDAFCARLDAILAWDRA
AVDATTEVKATLAAAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVAGLTFEDWVQ
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|