Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 157174..157919 | Replicon | plasmid pHSKP107-1 |
| Accession | NZ_CP100107 | ||
| Organism | Klebsiella pneumoniae strain HSKP107 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A331KSM6 |
| Locus tag | NIL13_RS27025 | Protein ID | WP_032408901.1 |
| Coordinates | 157428..157919 (+) | Length | 164 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | - |
| Locus tag | NIL13_RS27020 | Protein ID | WP_014386183.1 |
| Coordinates | 157174..157440 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIL13_RS26970 (NIL13_26950) | 152726..153139 | - | 414 | WP_013023817.1 | helix-turn-helix domain-containing protein | - |
| NIL13_RS26975 (NIL13_26955) | 153140..153418 | - | 279 | WP_004152721.1 | helix-turn-helix transcriptional regulator | - |
| NIL13_RS26980 (NIL13_26960) | 153408..153728 | - | 321 | WP_014386190.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| NIL13_RS26985 (NIL13_26965) | 153809..154033 | - | 225 | WP_014386189.1 | hypothetical protein | - |
| NIL13_RS26990 (NIL13_26970) | 154044..154256 | - | 213 | WP_014386188.1 | hypothetical protein | - |
| NIL13_RS26995 (NIL13_26975) | 154318..154644 | - | 327 | WP_014386187.1 | hypothetical protein | - |
| NIL13_RS27000 (NIL13_26980) | 155281..155631 | - | 351 | WP_014386186.1 | hypothetical protein | - |
| NIL13_RS27005 (NIL13_26985) | 155628..155900 | - | 273 | WP_032408902.1 | hypothetical protein | - |
| NIL13_RS27010 (NIL13_26990) | 156090..156575 | + | 486 | WP_014386185.1 | hypothetical protein | - |
| NIL13_RS27015 (NIL13_26995) | 156819..156977 | - | 159 | WP_014386184.1 | type I toxin-antitoxin system Hok family toxin | - |
| NIL13_RS27020 (NIL13_27000) | 157174..157440 | + | 267 | WP_014386183.1 | DUF1778 domain-containing protein | Antitoxin |
| NIL13_RS27025 (NIL13_27005) | 157428..157919 | + | 492 | WP_032408901.1 | GNAT family N-acetyltransferase | Toxin |
| NIL13_RS27030 (NIL13_27010) | 158360..158611 | - | 252 | WP_032408900.1 | aldo/keto reductase | - |
| NIL13_RS27035 (NIL13_27015) | 158808..160400 | - | 1593 | Protein_180 | IS66 family transposase | - |
| NIL13_RS27040 (NIL13_27020) | 160431..160781 | - | 351 | WP_014386180.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| NIL13_RS27045 (NIL13_27025) | 160778..161218 | - | 441 | WP_014386179.1 | transposase | - |
| NIL13_RS27050 (NIL13_27030) | 161480..162235 | - | 756 | WP_032408898.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(A) / blaOXA-1 / aac(6')-Ib-cr / blaCTX-M-15 / blaTEM-1B / mph(A) | - | 1..201929 | 201929 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17667.46 Da Isoelectric Point: 8.8757
>T250183 WP_032408901.1 NZ_CP100107:157428-157919 [Klebsiella pneumoniae]
VGKVTAPVPLGTSHILAEFHCGEPVLDEWIKHRGLKNQSLGAARTFVVCRGNASQVLAYYSLATGSVTHAIAPGSLRRNM
PDPVPVIILARLAVDTSYHGQGLGADLLHDAVLRCCRVAENIGVRAVMVHALSDSARQFYIHHGFIPSQTQDRTLFLRLP
LIT
VGKVTAPVPLGTSHILAEFHCGEPVLDEWIKHRGLKNQSLGAARTFVVCRGNASQVLAYYSLATGSVTHAIAPGSLRRNM
PDPVPVIILARLAVDTSYHGQGLGADLLHDAVLRCCRVAENIGVRAVMVHALSDSARQFYIHHGFIPSQTQDRTLFLRLP
LIT
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|