Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 157174..157919 Replicon plasmid pHSKP107-1
Accession NZ_CP100107
Organism Klebsiella pneumoniae strain HSKP107

Toxin (Protein)


Gene name tacT Uniprot ID A0A331KSM6
Locus tag NIL13_RS27025 Protein ID WP_032408901.1
Coordinates 157428..157919 (+) Length 164 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID -
Locus tag NIL13_RS27020 Protein ID WP_014386183.1
Coordinates 157174..157440 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIL13_RS26970 (NIL13_26950) 152726..153139 - 414 WP_013023817.1 helix-turn-helix domain-containing protein -
NIL13_RS26975 (NIL13_26955) 153140..153418 - 279 WP_004152721.1 helix-turn-helix transcriptional regulator -
NIL13_RS26980 (NIL13_26960) 153408..153728 - 321 WP_014386190.1 type II toxin-antitoxin system RelE/ParE family toxin -
NIL13_RS26985 (NIL13_26965) 153809..154033 - 225 WP_014386189.1 hypothetical protein -
NIL13_RS26990 (NIL13_26970) 154044..154256 - 213 WP_014386188.1 hypothetical protein -
NIL13_RS26995 (NIL13_26975) 154318..154644 - 327 WP_014386187.1 hypothetical protein -
NIL13_RS27000 (NIL13_26980) 155281..155631 - 351 WP_014386186.1 hypothetical protein -
NIL13_RS27005 (NIL13_26985) 155628..155900 - 273 WP_032408902.1 hypothetical protein -
NIL13_RS27010 (NIL13_26990) 156090..156575 + 486 WP_014386185.1 hypothetical protein -
NIL13_RS27015 (NIL13_26995) 156819..156977 - 159 WP_014386184.1 type I toxin-antitoxin system Hok family toxin -
NIL13_RS27020 (NIL13_27000) 157174..157440 + 267 WP_014386183.1 DUF1778 domain-containing protein Antitoxin
NIL13_RS27025 (NIL13_27005) 157428..157919 + 492 WP_032408901.1 GNAT family N-acetyltransferase Toxin
NIL13_RS27030 (NIL13_27010) 158360..158611 - 252 WP_032408900.1 aldo/keto reductase -
NIL13_RS27035 (NIL13_27015) 158808..160400 - 1593 Protein_180 IS66 family transposase -
NIL13_RS27040 (NIL13_27020) 160431..160781 - 351 WP_014386180.1 IS66 family insertion sequence element accessory protein TnpB -
NIL13_RS27045 (NIL13_27025) 160778..161218 - 441 WP_014386179.1 transposase -
NIL13_RS27050 (NIL13_27030) 161480..162235 - 756 WP_032408898.1 DeoR/GlpR family DNA-binding transcription regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(A) / blaOXA-1 / aac(6')-Ib-cr / blaCTX-M-15 / blaTEM-1B / mph(A) - 1..201929 201929


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(89-149)

Antitoxin

Vibrio phage ICP1, Orf50

(2-87)


Sequences

Toxin        


Download         Length: 164 a.a.        Molecular weight: 17667.46 Da        Isoelectric Point: 8.8757

>T250183 WP_032408901.1 NZ_CP100107:157428-157919 [Klebsiella pneumoniae]
VGKVTAPVPLGTSHILAEFHCGEPVLDEWIKHRGLKNQSLGAARTFVVCRGNASQVLAYYSLATGSVTHAIAPGSLRRNM
PDPVPVIILARLAVDTSYHGQGLGADLLHDAVLRCCRVAENIGVRAVMVHALSDSARQFYIHHGFIPSQTQDRTLFLRLP
LIT

Download         Length: 492 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10090.66 Da        Isoelectric Point: 5.1169

>AT250183 WP_014386183.1 NZ_CP100107:157174-157440 [Klebsiella pneumoniae]
MKSDVQLNIRAKEAQRALIDTAAEILHKSRTDFILEMACQAAENVILDRRMFNLNDEQYAEFIDMLDAPVTANPAMEKLL
ARKPQWAK

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A331KSM6

Antitoxin

Source ID Structure

References