Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 53668..54404 | Replicon | plasmid pHSKP107-1 |
| Accession | NZ_CP100107 | ||
| Organism | Klebsiella pneumoniae strain HSKP107 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | L7SZ15 |
| Locus tag | NIL13_RS26415 | Protein ID | WP_003026803.1 |
| Coordinates | 53922..54404 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | NIL13_RS26410 | Protein ID | WP_003026799.1 |
| Coordinates | 53668..53934 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIL13_RS26365 (NIL13_26350) | 49730..50092 | - | 363 | WP_215402459.1 | arsenite efflux transporter metallochaperone ArsD | - |
| NIL13_RS26370 (NIL13_26355) | 50142..50492 | - | 351 | WP_004152101.1 | As(III)-sensing metalloregulatory transcriptional repressor ArsR | - |
| NIL13_RS26375 (NIL13_26360) | 50850..51119 | + | 270 | WP_004152102.1 | hypothetical protein | - |
| NIL13_RS26380 (NIL13_26365) | 51107..51682 | + | 576 | WP_004152103.1 | hypothetical protein | - |
| NIL13_RS26385 (NIL13_26370) | 51713..52207 | + | 495 | WP_004152104.1 | DNA-binding protein | - |
| NIL13_RS26390 (NIL13_26375) | 52251..52619 | + | 369 | WP_004152105.1 | hypothetical protein | - |
| NIL13_RS26395 (NIL13_26380) | 52653..52856 | + | 204 | WP_004152106.1 | HHA domain-containing protein | - |
| NIL13_RS26400 (NIL13_26385) | 52905..53162 | + | 258 | WP_004152107.1 | hypothetical protein | - |
| NIL13_RS26405 (NIL13_26390) | 53238..53492 | + | 255 | WP_004152108.1 | hypothetical protein | - |
| NIL13_RS26410 (NIL13_26395) | 53668..53934 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| NIL13_RS26415 (NIL13_26400) | 53922..54404 | + | 483 | WP_003026803.1 | GNAT family N-acetyltransferase | Toxin |
| NIL13_RS26420 (NIL13_26405) | 54616..55962 | + | 1347 | WP_138920866.1 | ISNCY family transposase | - |
| NIL13_RS26425 | 56123..56254 | + | 132 | WP_004218042.1 | hypothetical protein | - |
| NIL13_RS26430 (NIL13_26410) | 56463..57628 | - | 1166 | Protein_59 | IS3 family transposase | - |
| NIL13_RS26435 (NIL13_26415) | 57805..58767 | - | 963 | Protein_60 | zinc metalloprotease HtpX | - |
| NIL13_RS26440 (NIL13_26420) | 58754..59242 | - | 489 | WP_004152114.1 | phosphate-starvation-inducible PsiE family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(A) / blaOXA-1 / aac(6')-Ib-cr / blaCTX-M-15 / blaTEM-1B / mph(A) | - | 1..201929 | 201929 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17353.97 Da Isoelectric Point: 9.5822
>T250182 WP_003026803.1 NZ_CP100107:53922-54404 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2GNW6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q8YL66 |