Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4855853..4856369 | Replicon | chromosome |
Accession | NZ_CP100106 | ||
Organism | Klebsiella pneumoniae strain HSKP107 |
Toxin (Protein)
Gene name | relE | Uniprot ID | R4YAY3 |
Locus tag | NIL13_RS23540 | Protein ID | WP_004178374.1 |
Coordinates | 4855853..4856137 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | NIL13_RS23545 | Protein ID | WP_002886901.1 |
Coordinates | 4856127..4856369 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIL13_RS23515 (4851337) | 4851337..4851600 | - | 264 | WP_020324507.1 | PTS system, lactose/cellobiose-specific IIB subunit | - |
NIL13_RS23520 (4851730) | 4851730..4851903 | + | 174 | WP_032408826.1 | hypothetical protein | - |
NIL13_RS23525 (4851906) | 4851906..4852649 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
NIL13_RS23530 (4853006) | 4853006..4855144 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
NIL13_RS23535 (4855385) | 4855385..4855849 | + | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
NIL13_RS23540 (4855853) | 4855853..4856137 | - | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NIL13_RS23545 (4856127) | 4856127..4856369 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
NIL13_RS23550 (4856447) | 4856447..4858357 | - | 1911 | WP_004178373.1 | PRD domain-containing protein | - |
NIL13_RS23555 (4858380) | 4858380..4859534 | - | 1155 | WP_004178372.1 | lactonase family protein | - |
NIL13_RS23560 (4859601) | 4859601..4860341 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T250179 WP_004178374.1 NZ_CP100106:c4856137-4855853 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A6THG1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |