Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4109316..4109935 Replicon chromosome
Accession NZ_CP100106
Organism Klebsiella pneumoniae strain HSKP107

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NIL13_RS20075 Protein ID WP_002892050.1
Coordinates 4109717..4109935 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NIL13_RS20070 Protein ID WP_002892066.1
Coordinates 4109316..4109690 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIL13_RS20060 (4104468) 4104468..4105661 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NIL13_RS20065 (4105684) 4105684..4108830 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
NIL13_RS20070 (4109316) 4109316..4109690 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NIL13_RS20075 (4109717) 4109717..4109935 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NIL13_RS20080 (4110094) 4110094..4110660 + 567 WP_002892030.1 maltose O-acetyltransferase -
NIL13_RS20085 (4110632) 4110632..4110772 - 141 WP_004147370.1 hypothetical protein -
NIL13_RS20090 (4110793) 4110793..4111263 + 471 WP_002892026.1 YlaC family protein -
NIL13_RS20095 (4111238) 4111238..4112689 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
NIL13_RS20100 (4112790) 4112790..4113488 + 699 WP_002892021.1 GNAT family protein -
NIL13_RS20105 (4113485) 4113485..4113625 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NIL13_RS20110 (4113625) 4113625..4113888 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T250177 WP_002892050.1 NZ_CP100106:4109717-4109935 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT250177 WP_002892066.1 NZ_CP100106:4109316-4109690 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References