Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 60650..61175 Replicon plasmid pHSKP33-2
Accession NZ_CP100104
Organism Klebsiella pneumoniae strain HSKP33

Toxin (Protein)


Gene name ccdB Uniprot ID D4HQE7
Locus tag NIL14_RS27405 Protein ID WP_013023785.1
Coordinates 60650..60955 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID W8V2V6
Locus tag NIL14_RS27410 Protein ID WP_001568025.1
Coordinates 60957..61175 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIL14_RS27375 (NIL14_27350) 56361..56987 + 627 WP_004197649.1 ParA family plasmid-partitioning AAA ATPase -
NIL14_RS27380 (NIL14_27355) 56984..57286 + 303 WP_004197636.1 hypothetical protein -
NIL14_RS27385 (NIL14_27360) 57726..58520 - 795 WP_004197635.1 site-specific integrase -
NIL14_RS27390 (NIL14_27365) 58718..59734 - 1017 WP_017899884.1 hypothetical protein -
NIL14_RS27395 (NIL14_27370) 59745..60059 - 315 WP_053389906.1 hypothetical protein -
NIL14_RS27400 (NIL14_27375) 60086..60481 - 396 WP_017899885.1 hypothetical protein -
NIL14_RS27405 (NIL14_27380) 60650..60955 - 306 WP_013023785.1 type II toxin-antitoxin system toxin CcdB Toxin
NIL14_RS27410 (NIL14_27385) 60957..61175 - 219 WP_001568025.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
NIL14_RS27415 (NIL14_27390) 61345..61806 - 462 WP_160880186.1 hypothetical protein -
NIL14_RS27420 (NIL14_27395) 61763..61993 + 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin -
NIL14_RS27425 (NIL14_27400) 61990..62406 + 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin -
NIL14_RS27430 (NIL14_27405) 62480..64042 + 1563 WP_004206609.1 AAA family ATPase -
NIL14_RS27435 (NIL14_27410) 64027..65049 + 1023 WP_000361404.1 helicase UvrD -
NIL14_RS27440 (NIL14_27415) 65305..66001 + 697 WP_024269734.1 IS1 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaKPC-2 / dfrA14 / qnrS1 - 1..120171 120171


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11615.30 Da        Isoelectric Point: 6.4672

>T250166 WP_013023785.1 NZ_CP100104:c60955-60650 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8392.34 Da        Isoelectric Point: 4.7405

>AT250166 WP_001568025.1 NZ_CP100104:c61175-60957 [Klebsiella pneumoniae]
MKQRITVTIDSDSYQLLKSADVNISALVNRAMQNEARRLRSERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2J4ZZW6

Antitoxin

Source ID Structure
AlphaFold DB A0A2J4ZZP8

References