Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 112868..113604 Replicon plasmid pHSKP33-1
Accession NZ_CP100103
Organism Klebsiella pneumoniae strain HSKP33

Toxin (Protein)


Gene name tacT Uniprot ID L7SZ15
Locus tag NIL14_RS26675 Protein ID WP_003026803.1
Coordinates 113122..113604 (+) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID L7SZ29
Locus tag NIL14_RS26670 Protein ID WP_003026799.1
Coordinates 112868..113134 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIL14_RS26625 (NIL14_26610) 108930..109292 - 363 WP_215402459.1 arsenite efflux transporter metallochaperone ArsD -
NIL14_RS26630 (NIL14_26615) 109342..109692 - 351 WP_004152101.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
NIL14_RS26635 (NIL14_26620) 110050..110319 + 270 WP_004152102.1 hypothetical protein -
NIL14_RS26640 (NIL14_26625) 110307..110882 + 576 WP_004152103.1 hypothetical protein -
NIL14_RS26645 (NIL14_26630) 110913..111407 + 495 WP_004152104.1 DNA-binding protein -
NIL14_RS26650 (NIL14_26635) 111451..111819 + 369 WP_004152105.1 hypothetical protein -
NIL14_RS26655 (NIL14_26640) 111853..112056 + 204 WP_004152106.1 HHA domain-containing protein -
NIL14_RS26660 (NIL14_26645) 112105..112362 + 258 WP_004152107.1 hypothetical protein -
NIL14_RS26665 (NIL14_26650) 112438..112692 + 255 WP_004152108.1 hypothetical protein -
NIL14_RS26670 (NIL14_26655) 112868..113134 + 267 WP_003026799.1 DUF1778 domain-containing protein Antitoxin
NIL14_RS26675 (NIL14_26660) 113122..113604 + 483 WP_003026803.1 GNAT family N-acetyltransferase Toxin
NIL14_RS26680 (NIL14_26665) 113816..115162 + 1347 WP_138920866.1 ISNCY family transposase -
NIL14_RS26685 115323..115454 + 132 WP_004218042.1 hypothetical protein -
NIL14_RS26690 (NIL14_26670) 115663..116828 - 1166 Protein_134 IS3 family transposase -
NIL14_RS26695 (NIL14_26675) 117005..117967 - 963 WP_004152113.1 zinc metalloprotease HtpX -
NIL14_RS26700 (NIL14_26680) 117954..118442 - 489 WP_004152114.1 phosphate-starvation-inducible PsiE family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..175328 175328


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(45-149)

Antitoxin

Vibrio phage ICP1, Orf50

(6-82)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17353.97 Da        Isoelectric Point: 9.5822

>T250165 WP_003026803.1 NZ_CP100103:113122-113604 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP

Download         Length: 483 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10147.59 Da        Isoelectric Point: 4.5256

>AT250165 WP_003026799.1 NZ_CP100103:112868-113134 [Klebsiella pneumoniae]
MKSDVQLNLRAKESQRALIDAAAEILHKSRTDFILEMACKAAENVILDRRVFNFNDEQYAEFIDMLDAPVEDEPAINKLL
ARKPQWDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J2GNW6

Antitoxin

Source ID Structure
AlphaFold DB A0A1Q8YL66

References