Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 38371..39014 | Replicon | plasmid pHSKP33-1 |
| Accession | NZ_CP100103 | ||
| Organism | Klebsiella pneumoniae strain HSKP33 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | - |
| Locus tag | NIL14_RS26280 | Protein ID | WP_014386165.1 |
| Coordinates | 38598..39014 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | - |
| Locus tag | NIL14_RS26275 | Protein ID | WP_032408893.1 |
| Coordinates | 38371..38601 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIL14_RS26250 (NIL14_26235) | 33444..34427 | - | 984 | WP_001471744.1 | NAD(P)H-quinone oxidoreductase | - |
| NIL14_RS26255 (NIL14_26240) | 34446..35594 | - | 1149 | WP_014386168.1 | ABC transporter ATP-binding protein | - |
| NIL14_RS26260 (NIL14_26245) | 35765..36922 | - | 1158 | WP_032408895.1 | acetylornithine deacetylase | - |
| NIL14_RS26265 (NIL14_26250) | 36938..37612 | - | 675 | WP_014386166.1 | DUF1028 domain-containing protein | - |
| NIL14_RS26270 (NIL14_26255) | 37617..38051 | - | 435 | WP_000103648.1 | RidA family protein | - |
| NIL14_RS26275 (NIL14_26260) | 38371..38601 | + | 231 | WP_032408893.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NIL14_RS26280 (NIL14_26265) | 38598..39014 | + | 417 | WP_014386165.1 | PIN domain-containing protein | Toxin |
| NIL14_RS26285 (NIL14_26270) | 39337..40303 | + | 967 | Protein_53 | IS5-like element IS903B family transposase | - |
| NIL14_RS26290 (NIL14_26275) | 40483..40857 | - | 375 | WP_032408891.1 | hypothetical protein | - |
| NIL14_RS26295 (NIL14_26280) | 40913..41239 | - | 327 | WP_004152639.1 | hypothetical protein | - |
| NIL14_RS26300 (NIL14_26285) | 41236..41964 | - | 729 | WP_014386162.1 | plasmid SOS inhibition protein A | - |
| NIL14_RS26305 (NIL14_26290) | 41961..42392 | - | 432 | WP_264237933.1 | conjugation system SOS inhibitor PsiB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..175328 | 175328 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15127.44 Da Isoelectric Point: 7.8841
>T250164 WP_014386165.1 NZ_CP100103:38598-39014 [Klebsiella pneumoniae]
MTKTYMLDTNICSYIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGAIGKRASPRHVQLVDAFCARLDAILAWDRA
AVDATTEVKATLAAAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVAGLTFEDWVQ
MTKTYMLDTNICSYIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGAIGKRASPRHVQLVDAFCARLDAILAWDRA
AVDATTEVKATLAAAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVAGLTFEDWVQ
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|