Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 14475..15220 | Replicon | plasmid pHSKP33-1 |
| Accession | NZ_CP100103 | ||
| Organism | Klebsiella pneumoniae strain HSKP33 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A331KSM6 |
| Locus tag | NIL14_RS26150 | Protein ID | WP_032408901.1 |
| Coordinates | 14729..15220 (+) | Length | 164 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | - |
| Locus tag | NIL14_RS26145 | Protein ID | WP_014386183.1 |
| Coordinates | 14475..14741 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIL14_RS26095 (NIL14_26080) | 10029..10442 | - | 414 | WP_013023817.1 | helix-turn-helix domain-containing protein | - |
| NIL14_RS26100 (NIL14_26085) | 10443..10721 | - | 279 | WP_004152721.1 | helix-turn-helix transcriptional regulator | - |
| NIL14_RS26105 (NIL14_26090) | 10711..11031 | - | 321 | WP_014386190.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| NIL14_RS26110 (NIL14_26095) | 11112..11336 | - | 225 | WP_014386189.1 | hypothetical protein | - |
| NIL14_RS26115 (NIL14_26100) | 11347..11559 | - | 213 | WP_014386188.1 | hypothetical protein | - |
| NIL14_RS26120 (NIL14_26105) | 11621..11947 | - | 327 | WP_014386187.1 | hypothetical protein | - |
| NIL14_RS26125 (NIL14_26110) | 12582..12932 | - | 351 | WP_014386186.1 | hypothetical protein | - |
| NIL14_RS26130 (NIL14_26115) | 12929..13201 | - | 273 | WP_032408902.1 | hypothetical protein | - |
| NIL14_RS26135 (NIL14_26120) | 13391..13876 | + | 486 | WP_014386185.1 | hypothetical protein | - |
| NIL14_RS26140 (NIL14_26125) | 14120..14278 | - | 159 | WP_014386184.1 | type I toxin-antitoxin system Hok family toxin | - |
| NIL14_RS26145 (NIL14_26130) | 14475..14741 | + | 267 | WP_014386183.1 | DUF1778 domain-containing protein | Antitoxin |
| NIL14_RS26150 (NIL14_26135) | 14729..15220 | + | 492 | WP_032408901.1 | GNAT family N-acetyltransferase | Toxin |
| NIL14_RS26155 (NIL14_26140) | 15661..15912 | - | 252 | WP_032408900.1 | aldo/keto reductase | - |
| NIL14_RS26160 (NIL14_26145) | 16109..17701 | - | 1593 | Protein_28 | IS66 family transposase | - |
| NIL14_RS26165 (NIL14_26150) | 17732..18082 | - | 351 | WP_014386180.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| NIL14_RS26170 (NIL14_26155) | 18079..18519 | - | 441 | WP_014386179.1 | transposase | - |
| NIL14_RS26175 (NIL14_26160) | 18781..19536 | - | 756 | WP_032408898.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..175328 | 175328 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17667.46 Da Isoelectric Point: 8.8757
>T250163 WP_032408901.1 NZ_CP100103:14729-15220 [Klebsiella pneumoniae]
VGKVTAPVPLGTSHILAEFHCGEPVLDEWIKHRGLKNQSLGAARTFVVCRGNASQVLAYYSLATGSVTHAIAPGSLRRNM
PDPVPVIILARLAVDTSYHGQGLGADLLHDAVLRCCRVAENIGVRAVMVHALSDSARQFYIHHGFIPSQTQDRTLFLRLP
LIT
VGKVTAPVPLGTSHILAEFHCGEPVLDEWIKHRGLKNQSLGAARTFVVCRGNASQVLAYYSLATGSVTHAIAPGSLRRNM
PDPVPVIILARLAVDTSYHGQGLGADLLHDAVLRCCRVAENIGVRAVMVHALSDSARQFYIHHGFIPSQTQDRTLFLRLP
LIT
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|