Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3765531..3766188 | Replicon | chromosome |
| Accession | NZ_CP100102 | ||
| Organism | Klebsiella pneumoniae strain HSKP33 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | W8UCT0 |
| Locus tag | NIL14_RS18205 | Protein ID | WP_002916310.1 |
| Coordinates | 3765778..3766188 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | W8UQ37 |
| Locus tag | NIL14_RS18200 | Protein ID | WP_002916312.1 |
| Coordinates | 3765531..3765797 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIL14_RS18175 (3760687) | 3760687..3762120 | - | 1434 | WP_004185559.1 | 6-phospho-beta-glucosidase BglA | - |
| NIL14_RS18180 (3762239) | 3762239..3762967 | - | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
| NIL14_RS18185 (3763017) | 3763017..3763328 | + | 312 | WP_004144734.1 | N(4)-acetylcytidine aminohydrolase | - |
| NIL14_RS18190 (3763492) | 3763492..3764151 | + | 660 | WP_002916317.1 | hemolysin III family protein | - |
| NIL14_RS18195 (3764302) | 3764302..3765285 | - | 984 | WP_020324927.1 | tRNA-modifying protein YgfZ | - |
| NIL14_RS18200 (3765531) | 3765531..3765797 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
| NIL14_RS18205 (3765778) | 3765778..3766188 | + | 411 | WP_002916310.1 | protein YgfX | Toxin |
| NIL14_RS18210 (3766195) | 3766195..3766716 | - | 522 | WP_004144730.1 | flavodoxin FldB | - |
| NIL14_RS18215 (3766817) | 3766817..3767713 | + | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
| NIL14_RS18220 (3767736) | 3767736..3768449 | + | 714 | WP_002916301.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NIL14_RS18225 (3768455) | 3768455..3770188 | + | 1734 | WP_004149758.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T250158 WP_002916310.1 NZ_CP100102:3765778-3766188 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GSW7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GY41 |