Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 3618059..3618900 | Replicon | chromosome |
Accession | NZ_CP100102 | ||
Organism | Klebsiella pneumoniae strain HSKP33 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A1M0WJM1 |
Locus tag | NIL14_RS17450 | Protein ID | WP_000854822.1 |
Coordinates | 3618517..3618900 (+) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A1M0CWL2 |
Locus tag | NIL14_RS17445 | Protein ID | WP_053271974.1 |
Coordinates | 3618059..3618427 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIL14_RS17420 (3614113) | 3614113..3615477 | + | 1365 | Protein_3403 | autotransporter adhesin family protein | - |
NIL14_RS17425 (3615804) | 3615804..3616622 | + | 819 | WP_001234702.1 | DUF932 domain-containing protein | - |
NIL14_RS17430 (3616713) | 3616713..3617198 | + | 486 | WP_000214317.1 | antirestriction protein | - |
NIL14_RS17435 (3617213) | 3617213..3617689 | + | 477 | WP_001186747.1 | RadC family protein | - |
NIL14_RS17440 (3617758) | 3617758..3617979 | + | 222 | WP_000692312.1 | DUF987 domain-containing protein | - |
NIL14_RS17445 (3618059) | 3618059..3618427 | + | 369 | WP_053271974.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
NIL14_RS17450 (3618517) | 3618517..3618900 | + | 384 | WP_000854822.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
NIL14_RS17455 (3618891) | 3618891..3619379 | + | 489 | WP_001177592.1 | DUF5983 family protein | - |
NIL14_RS17460 (3619346) | 3619346..3619588 | + | 243 | WP_166635458.1 | DUF957 domain-containing protein | - |
NIL14_RS17465 (3619685) | 3619685..3620530 | + | 846 | WP_001280435.1 | DUF4942 domain-containing protein | - |
NIL14_RS17475 (3620829) | 3620829..3621335 | + | 507 | WP_002917636.1 | G/U mismatch-specific DNA glycosylase | - |
NIL14_RS17480 (3621435) | 3621435..3623276 | - | 1842 | WP_004174339.1 | RNA polymerase sigma factor RpoD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14295.32 Da Isoelectric Point: 8.2830
>T250157 WP_000854822.1 NZ_CP100102:3618517-3618900 [Klebsiella pneumoniae]
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHQESKRCN
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHQESKRCN
Download Length: 384 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13679.41 Da Isoelectric Point: 6.4758
>AT250157 WP_053271974.1 NZ_CP100102:3618059-3618427 [Klebsiella pneumoniae]
VSDTFSGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLTDRAGIRGRFSDADANHLDQAFPLLMKQLELMLTSS
ELNPHRQNTVTLYVKGLTCHADTLGSCGYVYLAVYPTPEMKN
VSDTFSGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLTDRAGIRGRFSDADANHLDQAFPLLMKQLELMLTSS
ELNPHRQNTVTLYVKGLTCHADTLGSCGYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1M0WJM1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1M0CWL2 |