Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 2842253..2842878 | Replicon | chromosome |
Accession | NZ_CP100102 | ||
Organism | Klebsiella pneumoniae strain HSKP33 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | R4Y4A3 |
Locus tag | NIL14_RS13625 | Protein ID | WP_002882817.1 |
Coordinates | 2842253..2842636 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | J2DFR0 |
Locus tag | NIL14_RS13630 | Protein ID | WP_004150355.1 |
Coordinates | 2842636..2842878 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIL14_RS13610 (2839619) | 2839619..2840521 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
NIL14_RS13615 (2840518) | 2840518..2841153 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
NIL14_RS13620 (2841150) | 2841150..2842079 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
NIL14_RS13625 (2842253) | 2842253..2842636 | - | 384 | WP_002882817.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NIL14_RS13630 (2842636) | 2842636..2842878 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
NIL14_RS13635 (2843083) | 2843083..2844000 | + | 918 | WP_004181612.1 | alpha/beta hydrolase | - |
NIL14_RS13640 (2844014) | 2844014..2844955 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
NIL14_RS13645 (2845000) | 2845000..2845437 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
NIL14_RS13650 (2845434) | 2845434..2846294 | - | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
NIL14_RS13655 (2846288) | 2846288..2846887 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T250155 WP_002882817.1 NZ_CP100102:c2842636-2842253 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GPK8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GGU9 |