Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 1628856..1629475 Replicon chromosome
Accession NZ_CP100102
Organism Klebsiella pneumoniae strain HSKP33

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NIL14_RS07945 Protein ID WP_002892050.1
Coordinates 1629257..1629475 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NIL14_RS07940 Protein ID WP_002892066.1
Coordinates 1628856..1629230 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIL14_RS07930 (1624008) 1624008..1625201 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NIL14_RS07935 (1625224) 1625224..1628370 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
NIL14_RS07940 (1628856) 1628856..1629230 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NIL14_RS07945 (1629257) 1629257..1629475 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NIL14_RS07950 (1629634) 1629634..1630200 + 567 WP_002892030.1 maltose O-acetyltransferase -
NIL14_RS07955 (1630172) 1630172..1630312 - 141 WP_004147370.1 hypothetical protein -
NIL14_RS07960 (1630333) 1630333..1630803 + 471 WP_002892026.1 YlaC family protein -
NIL14_RS07965 (1630778) 1630778..1632229 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
NIL14_RS07970 (1632330) 1632330..1633028 + 699 WP_002892021.1 GNAT family protein -
NIL14_RS07975 (1633025) 1633025..1633165 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NIL14_RS07980 (1633165) 1633165..1633428 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T250151 WP_002892050.1 NZ_CP100102:1629257-1629475 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT250151 WP_002892066.1 NZ_CP100102:1628856-1629230 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References