Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 6953..7596 | Replicon | plasmid pHSKP43-2 |
| Accession | NZ_CP100100 | ||
| Organism | Klebsiella pneumoniae strain HSKP43 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | D8L2J9 |
| Locus tag | NIL15_RS27315 | Protein ID | WP_001044770.1 |
| Coordinates | 7180..7596 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D5KTK7 |
| Locus tag | NIL15_RS27310 | Protein ID | WP_001261282.1 |
| Coordinates | 6953..7183 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIL15_RS27270 (NIL15_27250) | 2166..2468 | + | 303 | WP_004197636.1 | hypothetical protein | - |
| NIL15_RS27275 (NIL15_27255) | 2916..3710 | - | 795 | WP_004197635.1 | site-specific integrase | - |
| NIL15_RS27280 (NIL15_27260) | 3908..4924 | - | 1017 | WP_017899884.1 | hypothetical protein | - |
| NIL15_RS27285 (NIL15_27265) | 4935..5249 | - | 315 | WP_053389906.1 | hypothetical protein | - |
| NIL15_RS27290 (NIL15_27270) | 5276..5671 | - | 396 | WP_017899885.1 | hypothetical protein | - |
| NIL15_RS27295 (NIL15_27275) | 5840..6145 | - | 306 | WP_013023785.1 | type II toxin-antitoxin system toxin CcdB | - |
| NIL15_RS27300 (NIL15_27280) | 6147..6365 | - | 219 | WP_001568025.1 | type II toxin-antitoxin system antitoxin CcdA | - |
| NIL15_RS27305 (NIL15_27285) | 6535..6996 | - | 462 | WP_160880186.1 | hypothetical protein | - |
| NIL15_RS27310 (NIL15_27290) | 6953..7183 | + | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NIL15_RS27315 (NIL15_27295) | 7180..7596 | + | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NIL15_RS27320 (NIL15_27300) | 7670..9232 | + | 1563 | WP_004206609.1 | AAA family ATPase | - |
| NIL15_RS27325 (NIL15_27305) | 9217..10239 | + | 1023 | WP_000361404.1 | helicase UvrD | - |
| NIL15_RS27330 (NIL15_27310) | 10495..11192 | + | 698 | WP_223174630.1 | IS1 family transposase | - |
| NIL15_RS27335 (NIL15_27315) | 11221..11493 | + | 273 | Protein_15 | transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaKPC-2 | - | 1..94059 | 94059 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15106.52 Da Isoelectric Point: 7.1084
>T250148 WP_001044770.1 NZ_CP100100:7180-7596 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GYM2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GZG3 |