Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 181070..181713 Replicon plasmid pHSKP43-1
Accession NZ_CP100099
Organism Klebsiella pneumoniae strain HSKP43

Toxin (Protein)


Gene name vagD Uniprot ID -
Locus tag NIL15_RS27145 Protein ID WP_014386165.1
Coordinates 181297..181713 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID -
Locus tag NIL15_RS27140 Protein ID WP_032408893.1
Coordinates 181070..181300 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIL15_RS27115 (NIL15_27095) 176143..177126 - 984 WP_001471744.1 NAD(P)H-quinone oxidoreductase -
NIL15_RS27120 (NIL15_27100) 177145..178293 - 1149 WP_014386168.1 ABC transporter ATP-binding protein -
NIL15_RS27125 (NIL15_27105) 178464..179621 - 1158 WP_032408895.1 acetylornithine deacetylase -
NIL15_RS27130 (NIL15_27110) 179637..180311 - 675 WP_014386166.1 DUF1028 domain-containing protein -
NIL15_RS27135 (NIL15_27115) 180316..180750 - 435 WP_000103648.1 RidA family protein -
NIL15_RS27140 (NIL15_27120) 181070..181300 + 231 WP_032408893.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NIL15_RS27145 (NIL15_27125) 181297..181713 + 417 WP_014386165.1 PIN domain-containing protein Toxin
NIL15_RS27150 (NIL15_27130) 182036..183004 + 969 WP_162496103.1 IS5-like element IS903B family transposase -
NIL15_RS27155 (NIL15_27135) 183184..183558 - 375 WP_032408891.1 hypothetical protein -
NIL15_RS27160 (NIL15_27140) 183614..183940 - 327 WP_004152639.1 hypothetical protein -
NIL15_RS27165 (NIL15_27145) 183937..184665 - 729 WP_014386162.1 plasmid SOS inhibition protein A -
NIL15_RS27170 (NIL15_27150) 184662..185093 - 432 WP_014386161.1 conjugation system SOS inhibitor PsiB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(A) / blaOXA-1 / aac(6')-Ib-cr / blaCTX-M-15 / blaTEM-1B / mph(A) - 1..201929 201929
- flank IS/Tn - - 182036..183004 968


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-130)

Antitoxin

SpoVT-AbrB domain

(7-55)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15127.44 Da        Isoelectric Point: 7.8841

>T250146 WP_014386165.1 NZ_CP100099:181297-181713 [Klebsiella pneumoniae]
MTKTYMLDTNICSYIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGAIGKRASPRHVQLVDAFCARLDAILAWDRA
AVDATTEVKATLAAAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVAGLTFEDWVQ

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8854.89 Da        Isoelectric Point: 4.5112

>AT250146 WP_032408893.1 NZ_CP100099:181070-181300 [Klebsiella pneumoniae]
MRTVSVFRNGNNRAIRLPRDLDFDGVNELEIIREGDTLILRPVKPSWSSFRQEEKADADFMAERENVVSDEGRFEL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References