Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4110890..4111509 Replicon chromosome
Accession NZ_CP100098
Organism Klebsiella pneumoniae strain HSKP43

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NIL15_RS20065 Protein ID WP_002892050.1
Coordinates 4111291..4111509 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NIL15_RS20060 Protein ID WP_002892066.1
Coordinates 4110890..4111264 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIL15_RS20050 (4106042) 4106042..4107235 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NIL15_RS20055 (4107258) 4107258..4110404 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
NIL15_RS20060 (4110890) 4110890..4111264 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NIL15_RS20065 (4111291) 4111291..4111509 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NIL15_RS20070 (4111668) 4111668..4112234 + 567 WP_002892030.1 maltose O-acetyltransferase -
NIL15_RS20075 (4112206) 4112206..4112346 - 141 WP_004147370.1 hypothetical protein -
NIL15_RS20080 (4112367) 4112367..4112837 + 471 WP_002892026.1 YlaC family protein -
NIL15_RS20085 (4112812) 4112812..4114263 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
NIL15_RS20090 (4114364) 4114364..4115062 + 699 WP_002892021.1 GNAT family protein -
NIL15_RS20095 (4115059) 4115059..4115199 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NIL15_RS20100 (4115199) 4115199..4115462 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T250139 WP_002892050.1 NZ_CP100098:4111291-4111509 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT250139 WP_002892066.1 NZ_CP100098:4110890-4111264 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References