Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 845436..846093 | Replicon | chromosome |
| Accession | NZ_CP100098 | ||
| Organism | Klebsiella pneumoniae strain HSKP43 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | W8UCT0 |
| Locus tag | NIL15_RS04220 | Protein ID | WP_002916310.1 |
| Coordinates | 845683..846093 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | W8UQ37 |
| Locus tag | NIL15_RS04215 | Protein ID | WP_002916312.1 |
| Coordinates | 845436..845702 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIL15_RS04190 (840592) | 840592..842025 | - | 1434 | WP_004185559.1 | 6-phospho-beta-glucosidase BglA | - |
| NIL15_RS04195 (842144) | 842144..842872 | - | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
| NIL15_RS04200 (842922) | 842922..843233 | + | 312 | WP_004144734.1 | N(4)-acetylcytidine aminohydrolase | - |
| NIL15_RS04205 (843397) | 843397..844056 | + | 660 | WP_002916317.1 | hemolysin III family protein | - |
| NIL15_RS04210 (844207) | 844207..845190 | - | 984 | WP_020324927.1 | tRNA-modifying protein YgfZ | - |
| NIL15_RS04215 (845436) | 845436..845702 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
| NIL15_RS04220 (845683) | 845683..846093 | + | 411 | WP_002916310.1 | protein YgfX | Toxin |
| NIL15_RS04225 (846100) | 846100..846621 | - | 522 | WP_004144730.1 | flavodoxin FldB | - |
| NIL15_RS04230 (846722) | 846722..847618 | + | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
| NIL15_RS04235 (847641) | 847641..848354 | + | 714 | WP_002916301.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NIL15_RS04240 (848360) | 848360..850093 | + | 1734 | WP_004149758.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T250132 WP_002916310.1 NZ_CP100098:845683-846093 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GSW7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GY41 |