Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 5840..6365 Replicon plasmid pHSKP5-2
Accession NZ_CP100096
Organism Klebsiella pneumoniae strain HSKP5

Toxin (Protein)


Gene name ccdB Uniprot ID D4HQE7
Locus tag NIL16_RS27290 Protein ID WP_013023785.1
Coordinates 5840..6145 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID W8V2V6
Locus tag NIL16_RS27295 Protein ID WP_001568025.1
Coordinates 6147..6365 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIL16_RS27260 (NIL16_27240) 1543..2169 + 627 WP_004197649.1 ParA family plasmid-partitioning AAA ATPase -
NIL16_RS27265 (NIL16_27245) 2166..2468 + 303 WP_004197636.1 hypothetical protein -
NIL16_RS27270 (NIL16_27250) 2916..3710 - 795 WP_004197635.1 site-specific integrase -
NIL16_RS27275 (NIL16_27255) 3908..4924 - 1017 WP_017899884.1 hypothetical protein -
NIL16_RS27280 (NIL16_27260) 4935..5249 - 315 WP_053389906.1 hypothetical protein -
NIL16_RS27285 (NIL16_27265) 5276..5671 - 396 WP_017899885.1 hypothetical protein -
NIL16_RS27290 (NIL16_27270) 5840..6145 - 306 WP_013023785.1 type II toxin-antitoxin system toxin CcdB Toxin
NIL16_RS27295 (NIL16_27275) 6147..6365 - 219 WP_001568025.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
NIL16_RS27300 (NIL16_27280) 6535..6996 - 462 WP_160880186.1 hypothetical protein -
NIL16_RS27305 (NIL16_27285) 6953..7183 + 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin -
NIL16_RS27310 (NIL16_27290) 7180..7596 + 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin -
NIL16_RS27315 (NIL16_27295) 7670..9232 + 1563 WP_004206609.1 AAA family ATPase -
NIL16_RS27320 (NIL16_27300) 9217..10239 + 1023 WP_000361404.1 helicase UvrD -
NIL16_RS27325 (NIL16_27305) 10495..11192 + 698 WP_223174630.1 IS1 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaKPC-2 - 1..94061 94061


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11615.30 Da        Isoelectric Point: 6.4672

>T250128 WP_013023785.1 NZ_CP100096:c6145-5840 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8392.34 Da        Isoelectric Point: 4.7405

>AT250128 WP_001568025.1 NZ_CP100096:c6365-6147 [Klebsiella pneumoniae]
MKQRITVTIDSDSYQLLKSADVNISALVNRAMQNEARRLRSERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2J4ZZW6

Antitoxin

Source ID Structure
AlphaFold DB A0A2J4ZZP8

References