Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 157173..157918 Replicon plasmid pHSKP5-1
Accession NZ_CP100095
Organism Klebsiella pneumoniae strain HSKP5

Toxin (Protein)


Gene name tacT Uniprot ID A0A331KSM6
Locus tag NIL16_RS27010 Protein ID WP_032408901.1
Coordinates 157427..157918 (+) Length 164 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID -
Locus tag NIL16_RS27005 Protein ID WP_014386183.1
Coordinates 157173..157439 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIL16_RS26955 (NIL16_26935) 152725..153138 - 414 WP_013023817.1 helix-turn-helix domain-containing protein -
NIL16_RS26960 (NIL16_26940) 153139..153417 - 279 WP_004152721.1 helix-turn-helix transcriptional regulator -
NIL16_RS26965 (NIL16_26945) 153407..153727 - 321 WP_014386190.1 type II toxin-antitoxin system RelE/ParE family toxin -
NIL16_RS26970 (NIL16_26950) 153808..154032 - 225 WP_014386189.1 hypothetical protein -
NIL16_RS26975 (NIL16_26955) 154043..154255 - 213 WP_014386188.1 hypothetical protein -
NIL16_RS26980 (NIL16_26960) 154317..154643 - 327 WP_014386187.1 hypothetical protein -
NIL16_RS26985 (NIL16_26965) 155280..155630 - 351 WP_014386186.1 hypothetical protein -
NIL16_RS26990 (NIL16_26970) 155627..155899 - 273 WP_032408902.1 hypothetical protein -
NIL16_RS26995 (NIL16_26975) 156089..156574 + 486 WP_014386185.1 hypothetical protein -
NIL16_RS27000 (NIL16_26980) 156818..156976 - 159 WP_014386184.1 type I toxin-antitoxin system Hok family toxin -
NIL16_RS27005 (NIL16_26985) 157173..157439 + 267 WP_014386183.1 DUF1778 domain-containing protein Antitoxin
NIL16_RS27010 (NIL16_26990) 157427..157918 + 492 WP_032408901.1 GNAT family N-acetyltransferase Toxin
NIL16_RS27015 (NIL16_26995) 158359..158610 - 252 WP_032408900.1 aldo/keto reductase -
NIL16_RS27020 (NIL16_27000) 158807..160399 - 1593 Protein_180 IS66 family transposase -
NIL16_RS27025 (NIL16_27005) 160430..160780 - 351 WP_014386180.1 IS66 family insertion sequence element accessory protein TnpB -
NIL16_RS27030 (NIL16_27010) 160777..161217 - 441 WP_014386179.1 transposase -
NIL16_RS27035 (NIL16_27015) 161479..162234 - 756 WP_032408898.1 DeoR/GlpR family DNA-binding transcription regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(A) / blaOXA-1 / aac(6')-Ib-cr / blaCTX-M-15 / blaTEM-1B / mph(A) - 1..201928 201928


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(89-149)

Antitoxin

Vibrio phage ICP1, Orf50

(2-87)


Sequences

Toxin        


Download         Length: 164 a.a.        Molecular weight: 17667.46 Da        Isoelectric Point: 8.8757

>T250126 WP_032408901.1 NZ_CP100095:157427-157918 [Klebsiella pneumoniae]
VGKVTAPVPLGTSHILAEFHCGEPVLDEWIKHRGLKNQSLGAARTFVVCRGNASQVLAYYSLATGSVTHAIAPGSLRRNM
PDPVPVIILARLAVDTSYHGQGLGADLLHDAVLRCCRVAENIGVRAVMVHALSDSARQFYIHHGFIPSQTQDRTLFLRLP
LIT

Download         Length: 492 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10090.66 Da        Isoelectric Point: 5.1169

>AT250126 WP_014386183.1 NZ_CP100095:157173-157439 [Klebsiella pneumoniae]
MKSDVQLNIRAKEAQRALIDTAAEILHKSRTDFILEMACQAAENVILDRRMFNLNDEQYAEFIDMLDAPVTANPAMEKLL
ARKPQWAK

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A331KSM6

Antitoxin

Source ID Structure

References