Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 53668..54404 Replicon plasmid pHSKP5-1
Accession NZ_CP100095
Organism Klebsiella pneumoniae strain HSKP5

Toxin (Protein)


Gene name tacT Uniprot ID L7SZ15
Locus tag NIL16_RS26400 Protein ID WP_003026803.1
Coordinates 53922..54404 (+) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID L7SZ29
Locus tag NIL16_RS26395 Protein ID WP_003026799.1
Coordinates 53668..53934 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIL16_RS26350 (NIL16_26335) 49730..50092 - 363 WP_215402459.1 arsenite efflux transporter metallochaperone ArsD -
NIL16_RS26355 (NIL16_26340) 50142..50492 - 351 WP_004152101.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
NIL16_RS26360 (NIL16_26345) 50850..51119 + 270 WP_004152102.1 hypothetical protein -
NIL16_RS26365 (NIL16_26350) 51107..51682 + 576 WP_004152103.1 hypothetical protein -
NIL16_RS26370 (NIL16_26355) 51713..52207 + 495 WP_004152104.1 DNA-binding protein -
NIL16_RS26375 (NIL16_26360) 52251..52619 + 369 WP_004152105.1 hypothetical protein -
NIL16_RS26380 (NIL16_26365) 52653..52856 + 204 WP_004152106.1 HHA domain-containing protein -
NIL16_RS26385 (NIL16_26370) 52905..53162 + 258 WP_004152107.1 hypothetical protein -
NIL16_RS26390 (NIL16_26375) 53238..53492 + 255 WP_004152108.1 hypothetical protein -
NIL16_RS26395 (NIL16_26380) 53668..53934 + 267 WP_003026799.1 DUF1778 domain-containing protein Antitoxin
NIL16_RS26400 (NIL16_26385) 53922..54404 + 483 WP_003026803.1 GNAT family N-acetyltransferase Toxin
NIL16_RS26405 (NIL16_26390) 54616..55962 + 1347 WP_138920866.1 ISNCY family transposase -
NIL16_RS26410 56123..56254 + 132 WP_004218042.1 hypothetical protein -
NIL16_RS26415 (NIL16_26395) 56463..57628 - 1166 Protein_59 IS3 family transposase -
NIL16_RS26420 (NIL16_26400) 57805..58767 - 963 Protein_60 zinc metalloprotease HtpX -
NIL16_RS26425 (NIL16_26405) 58754..59242 - 489 WP_004152114.1 phosphate-starvation-inducible PsiE family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(A) / blaOXA-1 / aac(6')-Ib-cr / blaCTX-M-15 / blaTEM-1B / mph(A) - 1..201928 201928


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(45-149)

Antitoxin

Vibrio phage ICP1, Orf50

(6-82)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17353.97 Da        Isoelectric Point: 9.5822

>T250125 WP_003026803.1 NZ_CP100095:53922-54404 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP

Download         Length: 483 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10147.59 Da        Isoelectric Point: 4.5256

>AT250125 WP_003026799.1 NZ_CP100095:53668-53934 [Klebsiella pneumoniae]
MKSDVQLNLRAKESQRALIDAAAEILHKSRTDFILEMACKAAENVILDRRVFNFNDEQYAEFIDMLDAPVEDEPAINKLL
ARKPQWDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J2GNW6

Antitoxin

Source ID Structure
AlphaFold DB A0A1Q8YL66

References